Tag: "diving" at biology news

UAF scientists discover new marine habitat in Alaska

...n depths in search of new species, a team of scuba diving scientists working from an Alaska fishing boat has...lifornia, Mexico. But in her more than 15 years of diving Alaska waters, she had never come across them. "The biggest ones may have been about the size ...

ORNL's Delmau joins Technology Review's list of top young innovators

... the clarinet, target shooting, kayaking and scuba diving among her outside interests. ...

Revealing bizarre deep-sea secrets

...ohnson-Sea-Link I submersible, which is capable of diving to3,000 feet. Besides Harbor Branch scientists, the expedition will includeresearchers from Duke University; the University of Queensland, Australia;the Whitney Lab of the University of Florida; the University of Ulm,Germany; and Physical Science, In...

Reaching for the gold

...of sports training programs, most notably the U.S. diving team. McNitt-Gray takes her lab on the road and w...ing trials held in late June for the U.S. Olympics diving team. She also coaches multi-event athletes at the ARCO Olympic Training Center in Chula Vista, Cali...

The Hunter's Breath tells a story of adventure and discovery in Antarctica

...eathe again. Physiological measurements of diving seals enabled Williams to calculate how much energy the seals had to expend to catch their meals. She also gained insights into how the seals manage to budget their oxygen supplies during dives that typically range from 20 to 40 minutes and sometimes...

Death and resurrection on Caribbean reefs

... years." The team collected their samples by scuba diving at Discovery Bay on the north coast of Jamaica. They worked long aluminum pipes into the reefs by hand, then pulled out cores representing timelines of reef history. By identifying and analyzing the condition of the fossil corals, they were able to ...

Can exercise before diving prevent decompression sickness?

Nowadays, scuba diving involves millions of people worldwide. Decompression sickness following diving is initiated by the formation of gas bubbles in tissue and blood. The most common decompression rel...

Purdue chemist 'mussels' in on secrets of natural adhesives

...g. "I was looking at mussels and barnacles while diving and wondered how they stick," he said. "I checked the literature for an answer and saw that many of the details for these processes were not known." This simple question of how mussels stick has turned into a years-long project for Wilker, occupyin...

Peregrine falcons may face new environmental threat

... for a bird that relies on surprising its prey and diving on it. Two BDE forms the penta and octa versions will be banned in member states of the European Union beginning later this year, and the main U.S. manufacturer of the products recently announced its plans to phase out production of penta- and octa...

Expedition will retrace legendary Steinbeck-Ricketts voyage to the Sea of Cortez

... archival tags, which continuously collect data on diving and migration. Only one tag was retrieved, but it ...nd I'd seen some incredible stuff in the kelp on a diving trip, so I bought the book to help me identify what I'd seen.'' Coincidentally, Baxter also had been...

Mantis shrimp fluoresce to enhance signaling in the dim ocean depths

...ntally discovered the fluorescence last year while diving with his underwater lighting and photography system. While he and a crew were videotaping the nighttime fluorescent world off the Bahamas, a large L. glabriuscula emerged from its burrow and displayed two bright "headlights." Mazel drew it to the att...

SPR Annual Meeting features newsworthy discoveries

...tact, he was trapped inside an immobile body--"the diving bell." The frightening question remains; how many more "butterflies" are trapped inside the passive bodies of brain damaged patients? In an attempt to answer this question, researchers have recently tested four patients each with severe brain injuri...

Scientists celebrate a sea turtles homecoming

...carapace, the devices send signals on location and diving patterns to researchers' computers via orbiting satellites. WCS uses the data to focus its efforts on where Pearl Cays hawksbill sea turtles need the most protection. More important than high-tech tools, however, is the education of local people abo...

New imaging vehicle maps coral reefs to determine health of reef and fisheries

...lf reefs, which are beyond the safe range of SCUBA diving at 90 to 200 feet deep and some 10 miles from land. Two reef areas, the Marine Conservation District Hind Bank and the South Drop, were surveyed in June south of St. Thomas and St. John in the US Virgin Islands by Woods Hole Oceanographic Institution...

Endangered northern right whales exposed to paralytic shellfish poisoning

...ted PSP toxin exposure will be seen in measures of diving capabilities, including dive times, swimming speed... and frequency of dives," added Durbin. "Impaired diving capabilities in right whales would lead to reduced ingestion rates and may be a possible explanation...

Science picks leads, feeds and story seeds (October 2002 edition)

...ssissippi River, streamgaging at Lake Tahoe, scuba diving and manatee tracking in Florida, and insect collections in national parks and wildlife refuges. To learn more and get involved in these and other USGS National Water Monitoring Day activities, visit http://water.usgs.gov/monitoring_day/activities.ht...

Robots powered by the ocean itself

... basin in missions that last months, all the while diving and rising between the surface and waters as deep as 3500 feet. It can be launched and recovered manually from a small boat, and so doesn't rely on costly ships for its deployment. Seaglider collects high resolution profiles of physical, chemical, a...

Tagging the great white shark...and a few of his friends

...ves where and why, what their migration routes and diving behaviors might be, and what might be going on in the ocean all around them temperature, salinity and other physical data. It's called the TOPP program Tagging of the Pacific Pelagics and it is funded as one of the six pilot projects currently...

Macarthur Award winning physiologist to present Scholander Award and lecture

...), who made important discoveries ranging from the diving reflex in marine mammals to the composition of atmospheric gases in ice cores, and who is considered one of the preeminent physiologists of the 20th century. Dr. Block will present the Scholander Award Lecture. Following her lecture, Dr. Block wil...

A message from nature to muskrats: 'Dont chill out'

...recovery from diving, or their ability to continue diving beyond the ADL (i.e. their capacity for anaerobic ... that many assume the muskrat adopts for increased diving time is related to a well-established finding that a drop in temperature reduces rates of cellular r...

1 2 3

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue