Tag: "dramatically" at biology news

Computer Program For Quicker, More Detailed Mapping

...apper produces high-quality genetic maps that will dramatically advancethe efforts of the Human Genome Project, whose goal is to map and sequencethe genetic blueprint that contains all of the instructions about how tomake a human body, said Richard Myers, professor of genetics and directorof the Stanford Human Ge...

PET Project Helps Reduce Pollution Threat From Heavy Metals

...scale experiments demonstrated thespecial sand can dramatically reduce the concentrations ofpollutants such as lead, cadmium, copper and zinc. This componenttakes care of the dissolved metals. The second part of the system, a layer of porous pavementconcrete block, acts as a giant strainer. "The system is a verye...

'Juliet' Evades Primate Center Expedition

...estruction. In fact, said Glander, the expedition dramatically showed how much pressurethe endangered animals are under. "Although we saw groups of animals on five of our eight days in theforest, the instant they saw us, they would run away," Glander said."We also found a lot of lemur traps and extensive cuttin...

Florida Company Using ORNL Technology For Revolutionary Wheelchair

...ernal recharging offeringincreased convenience and dramatically reduced down time. The TransRovr's lightweight, three-piece modular construction makes thewheelchair easy to pick up and transport in a car's trunk or back seat. Theseat portion of the unit, expected to be provided by Superior UnlimitedCorp. of Brist...

Environmental Impact Statements Need To Be Made Easier To Decipher

...d after"visuals increased individual understanding dramatically in a subsequentstudy. "When citizens can't understand the material presented in an EIS [environmentalimpact statement], they can't participate in the process," said WilliamSullivan, a professor of natural resources and environmental sciences atthe U...

Bottom-up Ecological Processes Better For Clear Waters, Study Finds

...kes or oceans with similaralgae production vary so dramatically in fisheries production?...

Erodible plastic microspheres could be effective oral drug delivery system

...rade, releasing theirtherapeutic load. The process dramatically increases the oral effectiveness ofseveral drugs. It suggests a new oral delivery system for compounds, such asinsulin, which until now could not be delivered orally. Editors: This news release is distributed in advance of publication for your info...

Isle Royale Moose Continue Decline

...n notes that the park's moose population had grown dramatically over the past 15 years. This was due to a population crash in '81 - '82 of their only predator, wolves. That wolf decline coincided with the arrival of canine parvovirus in the region. The dynamic relationship between moose, wolves, their environment...

Early Tests Indicate Motor Skills Unharmed In Consumers Of Tainted Fish

...in theGreat Lakes. While their levels have dropped dramatically since 1970, theyremain unacceptably high, according to health officials, who continue toissue advisories on fish consumption. Working with Schantz are Harold E.B. Humphrey and Marvin L. Budd of theMichigan Department of Community Health; Anne M. Swe...

Merging Physics And Neuroscience: First Evidence Of Self-Organized Criticality In Brain Networks

...d tissue may in fact produce wavepatterns that are dramatically different from the waves produced byhealthy tissue. "We have seen very rapid local oscillations in the calciumions of epileptic cells, which may correspond to a very noisy fieldwith low coherence," Cornell-Bell explained. "We hope to analyzethese p...

One Chimp Can Perceive States Of Awareness In Others

... specific chimp of a threat. "They responded dramatically when a threat was present but onlywhen the other animal in the pair was uninformed," Boysen said. Since the strongest reactions during the tests occurred with Kermitand Darrell, Boysen thinks that the social bond between two animals maybe the k...

Finished Your Lunch? Now Eat The Wrapper

...lon. However, earlier research in pigs hadshown it dramatically promoted the growth of beneficial bacteria, boosting their numbers tenfold. In the process it protected the bowel againstcancer and other diseases, including diarrhoea and constipation. Resultsin human research are equally promising. Modern Austral...

Colon Cancer Linked To Genes, Not Lifestyle

..., the incidence of colon cancer dramatically increases with aging," he said. Colon cancer is the third most common cancer in men, following prostate and lung cancer, and the third most common in women, following brea...

Experimental Trial Combines DNA Vaccine With Triple-Drug Therapy To Stop HIV

...h triple-drug therapy, which doesn't cure them but dramatically lowers theirviral load, allowing them perhaps to mount a more robust immune response. Thenwe're giving them the improved vaccine." Immunologically, the concept of a therapeutic DNA vaccine for a viralinfection poses something of a conundrum....

Fauci: New Findings Help Explain "Rebound" Of HIV In Patients Who Discontinue Triple-Drug Therapy

...were treated with both IL-2 and HAART did, indeed, dramatically decline in number. "This work provides the rationale to attempt to purge latently infected CD4+ T cells in HIV-infected patients by using a similar approach, i.e., by deliberately inducing virus exp...

New Heart-Attack Indicator Dramatically Improves Diagnostic Accuracy Of ER Doctors: TnT/Echocardiogram Combination Could Reduce Needless Admissions

...shownthat diagnostic accuracy of chest pain can be dramatically increased--up to 90percent, in some instances--by using a clinical approach that combines theresults of an echocardiogram with a simple blood test that measures a patient'stroponin T (TnT) levels. TnT is a protein released by the body during cardiacc...

Transposable Elements May Have Had A Major Role In The Evolution Of Higher Organisms

... one. That early picture, however, began to change dramatically in the1970s, when it became clear that transposons are pervasive. It simply made nosense that such elements would be conserved over thousands of millennia if theyhad no real function. So, a number of scientists, including McDonald, began tolook at th...

Prairies Will Be Hit Hard By Global Warming

...cosystems withfuture scenarios if society does not dramatically reduce its dependence onfossil fuels. Many kinds of migratory birds take shelter in temporary marshes thatform on farmland early in the year, Malcolm explains. As the climate warms,these marshes will dry up earlier and farmers will be tempte...

Late Blight Battle Goes Online, Marking 150 Year Struggle Since Irish Potato Famine

...rol causes significant economichardship because of dramatically increased fungicide costs. We hope thatthrough the continued research of plant pathologists worldwide, we'll find astrategy to effectively control late blight." The late blight feature website will only be available for a limited time. Login to ww...

Computer Models Find Cost-Effective Solutions For Species Preservation

...pecies "hotspots" are often real estate hot spots, dramatically increasingthe cost of conservation efforts. So, Ando developed a data base of land values and estimatedland values for 2,822 key counties across the United States. Cammfactored those values into a computer optimization model, and theresults provide a...

1 2 3 4 5 6 7 8 9 10

(Date:6/29/2015)... (PRWEB) , ... June 29, 2015 , ... ... recognized by the independent auditor of customer service for the 40-center nursing home ... than 1,100 skilled nursing centers in the United States in one or more ...
(Date:6/29/2015)... ... June 29, 2015 , ... ... filed against C.R. Bard, Inc. and Ethicon, Inc. continue to move forward ... next Case Management Conference is to be convened on Thursday, July 23rd at ...
(Date:6/29/2015)... ... ... USA Today reported on June 18th the overdose death rate has ... rest of the nation’s growing overdose death rates in 26 other states the U.S. ... stop the increasing overdose trend from continuing: , , Encourage and ...
(Date:6/29/2015)... ... June 29, 2015 , ... The world’s fastest and ... Aviation Museum to the Science Museum of Virginia. This iconic, supersonic stealth plane will ... , “Suspending a supersonic jet from the ceiling of a historic train station is ...
(Date:6/29/2015)... ... ... The Food Safety and Technology Research Centre under the ... (PolyU) has developed a new method for rapid authentication of edible oils and ... in food safety, and becomes particularly important with the emergence and widespread use ...
Breaking Medicine News(10 mins):Health News:National HealthCare Centers Receive 'Customer Experience Awards' 2Health News:National HealthCare Centers Receive 'Customer Experience Awards' 3Health News:National HealthCare Centers Receive 'Customer Experience Awards' 4Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 2Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 3Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 4Health News:Overdose Death Rates Decreased in Florida as of 2015 2Health News:Overdose Death Rates Decreased in Florida as of 2015 3Health News:SR-71 Prepares for Flight to Science Museum of Virginia 2Health News:PolyU develops a new method for rapid authentication of edible oils and screening of gutter oils 2
Other Tags
europainappropriatecharacterizationingeniumbecamealaskainertreactattemptinterviewingmotivationalexaminingelephantiasisclarifyingvolmanifesto