Tag: "drinking" at biology news

Discovery may jump-start mine remediation efforts

... into ground water and contaminate wells and other drinking water supplies. Working with Ken Kemner and collea...ns of ground water "down to values well below safe drinking water levels," says Banfield. "Many bioremediation schemes reduce contaminants, but not to a low eno...

Microbes make mine-waste drinkable, Science researchers report

...e bacteria can clean up contaminated water to meet drinking standards after they strip water of impurities and re-package them into zinc sulfide crystals called sphalerite. Characterized by their ability to naturally form sulfides, these bacteria may eventually explain how many low temperature zinc ore dep...

Scientists track phosphate to better understand global warming

... algae blooms that can affect taste and clarity of drinking water. Moreover, when algae die, thick pads sink to the bottom and oxidize, reducing dissolved oxygen and creating an environment inhospitable to fish. Too little phosphorus also is a problem. In old, weathered soils and in ocean ecosystems, plants ...

Why some people just can't seem to pay attention

...re studies on the causes and consequences of heavy drinking by teenage subjects."...

Smoking, heavy drinking and poor nutrition tend to cluster

... immediate use. A lifestyle of smoking and heavy drinking may predispose individuals to make poor food choic...individuals. "The combination of smoking, liberal drinking and poor nutrition conceivably elevates the risk for various chronic diseases such as cancer and car...

Searching for a genetic needle in a genome haystack

...omedical events, such as symptoms experienced when drinking ceases, and psychological aspects, such as the sub...to Crabbe, the earliest genetic studies on alcohol drinking in rats were published in the late 1940s. More serious and systematic genetic research began in the...

How sensitive is your brain to alcohol-induced damage?

...d brain damage." That's the bad news; that simply drinking alcohol can injure someone's brain, its neurotoxic...mage is a component of the progression from casual drinking to addiction," said Crews. "We know that alcoholics have decreased brain size. Clinical studies ha...

The role of science in restoring California's water resources

...he Sierra Nevada mountains is siphoned off to meet drinking and irrigation needs for the rest of the state. ...stem that drains into San Francisco Bay - provides drinking water to 20 million people, irrigates millions of acres of farmland and serves as a recreational pla...

UC Davis study finds heart benefits from apples & juice

...t UC Davis School of Medicine have determined that drinking apple juice and eating apples has a beneficial eff...though Hyson expected to see positive results from drinking apple juice and eating apples, she was surprised to find beneficial effects after only six weeks. "...

One in three fatal bicycle accidents linked to alcohol

...8 g/dL. Only 5 percent of the injured who had been drinking wore helmets. Thirty percent of the injured bicyclists who had elevated blood alcohol levels also had a history of DWI (driving while intoxicated) citations; some probably used bicycles as a form of transportation because their driver's licenses had...

Elephants pick up good vibrations - through their feet

... in 1992," she recalls. "I was observing them at a drinking hole when I noticed this strange set of behaviors. They would lean forward, pick up one leg and freeze for no apparent reason." She theorized that the elephants were responding to vibrations in the ground from approaching herds. "When I returned to t...

Geologists explore beach nourishment controversies, groundwater quality, and Blue Ridge mountain issues

...wide crater whose presence currently threatens the drinking water of area residents. Working from July through...uifer storage and recovery (ASR), in which treated drinking water is stored in aquifers during periods of low demand (i.e., the winter months), may help the GUC...

Research on bioengineered crops, global warming and a new flu vaccine will be featured at gathering of world's largest scientific society in San Diego

...ng to a University of Scranton researcher. He says drinking cranberry juice raises the levels of antioxidants in plasma, and that this can offset the adverse effects that sugars in soft drinks and fruit juices have on antioxidants. (AGFD 94, Tuesday, April 3, 3:00 p.m.) Wednesday, April 4 Wood prese...

Drinking Water from Forests and Grasslands: A Synthesis of the Scientific Literature

...ork, ordering it in restaurants. The purity of our drinking water no longer strikes everyone as a given. The S...stablished a time line to assess the status of all drinking water sources across the country and to publish the results by 2003. Southern Research Station scien...

Synthetic clay could assist radioactive waste cleanup

...nmentally harmful materials from waste streams and drinking water. A team led by Sridhar Komarneni, profess...ls that can leach into groundwater and contaminate drinking water supplies. "This result represents significant progress in developing new ion-separation...

Increased use of chemicals in agriculture worldwide seen as major environmental threat

...g its ecology. Ecosystem "services" such as clean drinking water and carbon storage continue to be lost. "Neither society nor most scientists understand the importance of agriculture," said Tilman. "It's grossly misunderstood, barely on the radar screen, yet it is likely as important as climate change...

Do the effects of prenatal exposure to alcohol differ by culture?

...f alcohol on children resulting from their mothers drinking during pregnancy are comparable across cultures. In other words, irrespective of their color of the skin or culture, children prenatally exposed to alcohol show similar patterns of impairments." Savage agreed that the study's results provide c...

A stomach enzyme deficit may place women at more risk from drinking alcohol

...ieve higher blood alcohol levels than men do after drinking a similar amount of alcohol for several different ...more cautious than males in terms of the amount of drinking that they do," he said. "This study also teaches us a great deal about the processing of alcohol. ...

A neurogenetic approach to alcoholism

...cohol intake." Having fewer negative effects from drinking alcohol means the same thing as having a low response to alcohol; these are people who can 'drink like a fish' without getting drunk. Sons of alcoholics, for example, are often 'low responders' and most likely to develop alcoholism themselves. "Two...

National survey reveals profound lack of scientific knowledge

...he economy. Recent debates over arsenic levels in drinking water, testing for salmonella in school lunches, oil-drilling in the Arctic National Wildlife Refuge, the Kyoto global warming agreement, as well as the California energy crisis, illustrate the type of science-based issues the country confronts every...

1 2 3 4 5 6 7 8 9 10

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid