Tag: "dust" at biology news

Research to estimate pesticides' effects on children

... particles while crawling and playing in household dust or tracked-in soil. He said that, unlike adults, children are far more sensitive to low concentrations of toxic chemicals because of their developing organs, high metabolism and high skin-surface-area-to-body-weight ratio. "In a growing body, cellul...

The greening of the North: real, and caused by climate change

...end, which was promptly resumed after the volcanic dust had settled. The Pinatubo eruption had another effect too, which greatly surprised carbon cycle scientists when it occurred: The rate of increase of carbon dioxide in the atmosphere suddenly slowed down for two years. A full explanation for this (whi...

Large volcanic eruptions affect the 'greener greenhouse'

... last 20 years was interrupted because of the tiny dust particles (aerosols) shot into the atmosphere by the eruption of Mount Pinatubo," said Ranga Myneni, co-author of the study, and professor at Boston University. The increased amount of aerosols cast into the upper atmosphere from the eruption caused ...

People linked to new sea otter diseases

...g spores of a soil fungus (Coccidiodes immitis) in dust raised by construction and agriculture. "The emergence of valley fever as an otter disease corresponds with an increase in human cases in California," say Lafferty and Gerber. Dust control efforts that reduce human exposure to valley fever may also h...

Cosmic impacts implicated in both the rise and fall of dinosaurs

...tions in eastern North America, as well as iridium dust and magnetic fields in four corresponding sediment layers in the Newark Basin. The team published its findings, "Ascent of Dinosaurs Linked to an Iridium Anomaly at the Triassic-Jurassic Boundary," in the May 17 edition of the journal Science. "Findi...

Genomic study breathes new life into asthma research

...number of genes plus environmental factors such as dust and pollen which can trigger bouts of asthma. A research team from the Schering-Plough Research Institute in New Jersey, are the first to produce a profile of the genes expressed during a simulated asthma attack in the Philippine cynomolgus monkey. ...

Most definitive study yet shows tiny particles in air are linked to lung cancer

... high concentrations of tiny particles of soot and dust significantly increases the risk of dying from lung cancer and heart disease, according to a new nationwide study. Over many years, the danger of breathing soot-filled air in polluted cities is comparable to the health risks associated with long-ter...

E. coli bacteria make Alzheimers-linked fibers

...on is similar to the formation of a snowflake on a dust particle. The particle is a nucleus that triggers ... the bacterium and is exposed to the outside. Like dust particles in snowflake production, each B protein is a nucleus that triggers the precipitation of di...

The K-T impact extinctions: Dust didn't do it

...extinction? The conventional theory is that impact dust obscured the sun, shutting down photosynthesis and...ntial impact effects. Based on the old, inaccurate dust numbers, which erroneously suggested that a medium-sized asteroid (1-2 km in diameter) could cause g...

Is there a link between alcohol and allergies?

...topic patients (253 or 78%) were allergic to house dust mites. Using 10 grams as a measure of one drink, ... Gonzlez-Quintela. "In patients allergic to house dust mites, regular alcohol intake was associated with increased serum levels of specific IgE against the...

Tracking and treating toxic waste in urban neighborhoods

... sites through rainfall runoff or aboard windswept dust particles. These new tracking methods should help local officials, developers and community leaders decide on the best way to remove or neutralize the hazardous wastes. In some cases, the researchers may conclude that the Earth's natural self-cleansi...

New bacteria target cancers in mice

... (C.novyi). C.novyi is normally found in soil and dust and contains a toxin that can cause lethal side effects in animals. They genetically modified the bacteria to remove the toxin gene to make them harmless to normal animals. Then, they injected spores of these bacteria and conventional chemotherape...

ORNL conducting field test of instruments to detect lead

... - Instruments and methods to detect lead in house dust will get a tryout at a field verification event co...speed the identification and cleanup of lead-laden dust in homes. Nearly 1 million children in the United States have lead levels in their blood that are hi...

Anthrax dectectors are coming

...esearch showed that common substances such as road dust and soot behaved differently than bacteria, Small said. Dr. Small has successfully tested biological particles ranging in size from 1 to 10 microns by using lasers and acoustic sensors to detect and identify microbes. In the research, laser pulses we...

Univ. of Fla. professor: Air cleaning system destroys Anthrax, other pathogens

...or air cleaning system originally developed to zap dust mites and mold spores also destroys airborne anthr... bullet for the bacteria, Goswami said, destroying dust mites, mold spores and pathogens by disrupting or disintegrating their DNA. Goswami came up wit...

Dust from Africa leads to large toxic algae blooms in Gulf of Mexico, study finds

Saharan dust clouds travel thousands of miles and fertilize the...y problems in humans. Each year iron from Saharan dust clouds is deposited in the waters off the West Florida coast. Once there, plant-like bacteria use th...

For peppers, hot quite literally the spice of life, UF research shows

... and was never observed in nature, and it gathered dust in scholarly journals until Tewksbury and Nabhan decided to see if it might hold true in chili peppers. The researchers did their investigation in a field in Southern Arizona about 35 miles south of Tucson, using the Chiltepine chili pepper, Capsicu...

Polyunsaturated fats implicated in rise in asthma in pre-school children

...ssess their response to common allergens including dust mite, egg, cow's milk, and rye grass. Around one in five children had asthma. A child with an allergic response to one or more components of the skin prick test was almost 2.5 times as likely to have recent asthma as children with a negative test. ...

Engineers develop technology to reduce industry emissions

...which use heavy, expensive steel plates to attract dust particles, Pasic said. When coal is burned for fuel, it produces exhaust thick with fly ash, which contains trace metals such as arsenic that pose potential health hazards if inhaled. As the fly ash moves through the power plant's exhaust system, t...

Worlds largest scientific society convenes regional meeting June 14-17 in Seattle

...cussed. Other topics include effects of windblown dust on human health and air pollution from Asia and Canada to the United States. (Leonard Barrie, Global Environmental Change Department, Pacific Northwest National Laboratory, Richland, Wash., leonard.barrie@pnl.gov ). What goes around comes around ...

1 2 3 4 5 6 7 8

(Date:8/29/2014)... Pursuing its deepest desires to help build ... stunning new design that promises to redefine the global ... surrogacy platform has witnessed a 42 percent increase in ... month, the FindSurrogateMother.com community is formed by hopeful parents ... — the precious gift of life. , Whether intended ...
(Date:8/29/2014)... News) -- If you have bunions, taking care of them ... expert says. A bunion is a bump that forms ... tissue moves out of place and extends beyond the normal ... pain and may require surgery to correct, said Brent Rosenthal, ... Freehold, N.J. To prevent bunions, avoid wearing shoes with ...
(Date:8/29/2014)... NEW YORK August 29, 2014 - Despite US ... obesity, there are many barriers, several of which may ... study by researchers at NYU Langone Medical Center published ... General Internal Medicine ( JGIM ). , David ... Department of Internal Medicine at NYU Langone, and colleagues ...
(Date:8/29/2014)... AURORA, Colo. (Sept. 2, 2014) A team of ... has reported the breakthrough discovery of a process to ... patients. These findings could have implications that extend beyond ... and autoimmune diseases., In an article published ... the Charles C. Gates Center for Regenerative Medicine and ...
(Date:8/29/2014)... 29, 2014 Today, NBC’s “The ... who profiled a handful of safe, back to ... Research. This year, many schools will include earphones ... innovator of hearing wellness solutions, offers the best ... Earphones, offered in yellow, pink and black, sound ...
Breaking Medicine News(10 mins):Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 2Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 3Health News:Take Steps to Control Bunions 2Health News:Options for weight loss your primary care doctor might not know about 2Health News:CU scientists' discovery could lead to new cancer treatment 2Health News:The Today Show Features ETY•Kids® Safe-Listening Earphones by Etymotic 2
Other Tags
hayfevershotantelopesaigakineticsilymarinplasticityinvasionsendocrineaaccmightdiscovereddefectataxiafriedreichreverses