Tag: "dysfunctions" at biology news

Genetic screening recommended to detect new neurodegenerative disorder in men over age 50

...f FXTAS in men and suggested that the neurological dysfunctions could be due to the elevated levels of messenger RNA from the FMR1 gene mutation, which are consistently observed in the blood of premutation carriers. As a result, they proposed the hypothesis that FXTAS results from an RNA toxic gain-of-function. ...

Can EPO prevent loss of brain function in schizophrenia?

...and cellular mechanisms accounting for the various dysfunctions of schizophrenic psychosis are far from clear. Existing animal models of schizophrenia only reflect certain aspects of the human disease. Therefore, novel concepts to treating schizophrenia should be immediately translated into clinical pilot trials....

Small-molecule inhibitors of botulinum neurotoxin identified

...eutic agents for treating a wide variety of muscle dysfunctions in humans, and are used cosmetically to reduce wrinkles. Paradoxically, the seven serotypes of BoNT, designated A through G, also are among the most lethal biological substances known. Botulinum neurotoxins are composed of two peptide chains, a heav...

Wake Forest researcher identifies syndrome as leading cause of death in premature infants

... may be able to prevent premature births and brain dysfunctions such as cerebral palsy and mental retardation," he said. For neonatalogists, this breakthrough could mean the answers to questions that have been haunting physicians for years. "This finding is very exciting for many reasons," said Steve Block, M.D.,...

UB dental researchers find novel peptide in saliva that kills broad range of fungi and bacteria

...mponent of artificial saliva for treating salivary dysfunctions that result in increased plaque formation, cavities, gum disease and fungal infections."...

Vitamin-like substance leads to dramatic improvements in patients with muscular disorder

...ers known as hereditary ataxias - brain-and-muscle dysfunctions that disrupt balance and coordination of the arms, legs, and speech. Six patients with hereditary ataxia improved greatly after taking a substance called coenzyme Q10, or CoQ10, Columbia researchers report. Once wheelchair-bound patients walked agai...

Mice show function of gene that causes two types of blindness

...tor cells. When a mutation occursin ABCR, then RmP dysfunctions and cannot perform its transporter role. "Our research revealed, among other things, the biochemical change inpatients with Stargardt's that makes vision more difficult when coming fromsunshine into a dimly lit room," said Dr. Gabriel Travis...

Cedars-Sinai Medical Tip Sheet For April 15 (A)

... host ofsources--ranging from tension and hormonal dysfunctions to meningitis and braintumors--an occasional headache should not be overly alarming but recurringheadaches should not be overlooked. Van Gogh Exhibit Is "Bridge To Wellness" The Van Gogh exhibit at the Los Angeles County Museum of Art may...

Brain Mapping In Real Time

...ning for precision neurosurgery to treat cognitive dysfunctions mapped to a specific brain site....

1

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting