Tag: "easier" at biology news

Putting GPS to work, researchers shed light on road-following by pigeons

...reference for roadway following could form because easier navigation may allow brain processing-time and power to be directed to other tasks, such as watching for predators. The pigeons appeared to be attracted to the SS Aurelia, Italy's old coastal highway, to a greater extent than the newer and larger hig...

ORNL nanoprobe creates world of new possibilities

...ey settled on silver-island films because they are easier to reproduce than silver-coated particles and they form only a thin coating, which helps maintain the nanoscale diameter of the tapered tip. The development of the SERS nanoprobe could lead to increasing interest in SERS as an ultra-sensitive detecti...

Gene profiles could improve acute leukemia diagnosis and lead to better treatments

...nowing which subtype of AML a patient has makes it easier to determine the best treatment and that treatment's chance of success, according to Downing. "This study will also contribute to our understanding of the various underlying causes of AML. In other words, it will help take a lot of the educated guess...

Endurance exercise found to be equally effective as diuretics in improving cardiac health

...have fewer and less severe side effects, making it easier to stay on medication. In addition, the diuretics are relatively inexpensive. Exercise has always been recommended for good cardiac health. So what should the at-risk, older American do to sustain good cardiac health? Background Hypertension or hig...

Noah's modern ark: The role of ART in conserving endangered species

...gst captive populations. For instance, it is much easier to transport eggs or sperm from one institution to another, than to transport a killer whale or elephant. In addition, there are animals such as the giant panda who simply do not feel any sexual attraction to the mate chosen for them and refuse to o...

New technique images gene expression in mice

...it turns out, identifying genetic flaws has proved easier than getting corrected genes to work in the cells that need them. Researchers at the Departments of Nuclear Medicine (Radiology) and Pediatrics at Case Western Reserve University may be able to help. They have demonstrated a technique that provides a...

Natural, man-made mix promises biggest landscape plant growth

...es in their lives. "In other words, they make it easier for the roots of plants to access water and nutrients, which is important in producing plants and establishing them in the landscape/garden," Davies explained. Though somewhat beneficial under a variety of conditions, this plant "upper" seems to wor...

Brain disease research, particle physics meet in the middle (ware)

...s that simplify resource sharing, NMI is making it easier for scientists, engineers and educators to work with colleagues on a worldwide scale through high-speed networks. The integrated tools from NMI facilitate collaborations across organizations, information technology architectures, operating systems a...

Cutting back on cigarettes: when less is more

...le greater amounts of smoke because it is somewhat easier to take in, compared to non-mentholated smoke. Researchers also found that black menthol smokers had higher carbon monoxide levels compared to white smokers in a restricted environment. Because both black and white menthol smokers registered higher ...

Mouse study yields clue to why liver is less prone to rejection, say Pitt researchers

...'t have enough information to understand why it is easier to get liver transplant patients off anti-rejection drugs compared to recipients of other organs," said Dr. Thomson. In a mouse model, researchers compared the expression of TLR-4 and other Toll-like receptors by liver dendritic cells to dendritic ce...

From algae, weeds and people: new genetic clues to complex obesity syndrome

...in an alga called Chlamydomonas. The alga provides easier access than other organisms to examine cilia and related structures called flagella, which also help with cells' own movement. To find new genes and proteins involved in cilia, Dutcher and her team compared all the proteins predicted by the alga's a...

'Nanobodies' herald a new era in cancer therapy

...ey are very stable, soluble proteins that are much easier and less expensive to produce than conventional antibodies. So, researchers have recently begun to evaluate nanobodies as anti-cancer medicines. The first results look promising: in experiments conducted on mice, a tumor with a certain protein on ...

Orange, tangerine peels could be better than drugs for lowering cholesterol

...ealth benefits, taking PMF supplements could be an easier way to lower cholesterol, since a person would have to drink 20 or more cups a day of orange or tangerine juice to have a therapeutic effect, Kurowska estimates. KGK Synergize already has developed a nutrition supplement containing PMFs combined wit...

New research at UNC shows ribosomes do not function as conventional enzymes

...ain. The path on the enzyme is lower, and so it is easier to follow it." Energy has two components, Sievers said. One is heat (enthalpy), the other one refers to the order of a system (entropy). It's possible for an enzyme to lower either of those energy components. Direct chemical involvement of an enzyme ...

Gene-based screen sorts cancer cases, say Stanford researchers

... a technique called RT-PCR. This approach would be easier for medical labs, which already use RT-PCR for other disease tests. Levy said although microarrays and RT-PCR give similar information, the new test is more likely to become widely used if it is easy to incorporate into existing medical labs. "You wa...

New studies show Curves Program raises metabolic rate in overweight and sedentary women

...tive muscle, which decreases REE and makes it even easier to regain weight while eating fewer calories. But the combination of strength training and a high protein / low carb / low fat diet actually increases REE and protects muscle, which leads to the burning of fat stores and the ability to eat a healthy ...

More useful plants may sprout from gene role discovery

...le to alter plants so they are more nutritious and easier to process without weakening them so much they fall over, according to Purdue University researchers who found a new twist in a plant formation biochemical pathway. Decreasing the amount of two acids in plant cell walls may enhance livestock feed dig...

Florida Tech researchers win $912,700 grant for cell studies

...interacting in a test tube. Test tube studies are easier to perform, but don't always reflect real life. Our advantage is that we have developed unique methods to evaluate what is actually happening inside a living cell to prove the validity of our biochemical measurements and the measurements made in oth...

U of T researchers isolate gene for Crohn's disease

...his protein functions improperly and allows toxins easier access to the cell. The ability to test for this protein malfunction will help physicians distinguish between Crohn's disease and ulcerative colitis, the other major form of inflammatory bowel disease known. The malfunction is not present in ulcerat...

Researchers find no safe place to sit in California tick-infested forest

... discovers the tick that bit them. But they become easier to detect once they start swelling up a bit after they've had a blood meal. "Animal studies suggest that it usually takes longer than one day after the tick becomes attached for the bacteria to be transmitted to the host, so the sooner the tick is f...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker