Tag: "effectiveness" at biology news

Gene-Altered Mouse May Provide New Insights To Parkinson's Disease, Substance Abuse And Schizophrenia

...phrenia block dopamine receptors, theyhave limited effectiveness and produce side effects in many patients. "Years of research by many investigators have helped determine thecellular components that regulate dopamine levels in the synapse,"said Giros, now a researcher at INSERM in Paris. "We are now in thepositio...

Rosemary May Have Anti-Cancer Properties

...cent. The researchers also found that rosemary's effectiveness against tumor formationincreased with the amount of fat in the diet. "It suggests that people who eat high-fat diets will actually get themost benefit from rosemary," Milner says. "For typical Americans,who eat more fat than they should, rosemary m...

Erodible plastic microspheres could be effective oral drug delivery system

... load. The process dramatically increases the oral effectiveness ofseveral drugs. It suggests a new oral delivery system for compounds, such asinsulin, which until now could not be delivered orally. Editors: This news release is distributed in advance of publication for your information only. Please respect Nat...

Project Shows Native Bacteria Can Destroy Widespread Pollutant In Groundwater

...uifer. Several experts also had suggested that the effectiveness of the bacteria at degrading the toluene might lessen over time. So McCarty and his colleagues began looking for a site for a full-scale test. One of the biggest barriers they faced was the fact that they wanted to use toluene, which is itself a regu...

Low Iron Levels Cause Weakness In Women Who Are Not Anemic

...future, we should be able to accurately assess the effectiveness of mass iron supplementation and food fortification programs in countries with serious anemia problems, once we have adapted these indicators of functional impairment for field use," Haas said. To improve iron status through diet, Haas and Zhu recomm...

Better Peroxidase Improves Disease Diagnosis

...es, including AIDS and malaria. Standard kits lose effectiveness in about four months without refrigeration, according to industry sources. Vierling's preliminary research suggests that kits made with soybean peroxidase should last unrefrigerated for at least a year. Such kits will be very useful in places such as...

Yale Breakthrough In Destroying Drug-Resistant Bacteria Focuses On Thwarting Genes That Cause Resistance

...zer. Theentire process of finding and testing the effectiveness of a specific EGS takesonly a few weeks or months compared to years required for the development ofmost antibiotics....

Environmental Engineers Demonstrate Effective Method For Trapping Highway Pollutants

...tch ofinterstate highway in the state of Ohio. The effectiveness of the PET system varied for each specificmetal, but the overall trapping efficiencies ranged from 82 to 97percent. The PET even holds up well during heavy rainstorms. Thesystem can handle up to one inch of rain per hour. That's whenSansalone discove...

Harbor Branch Oceanographic Institution Receives $1.1 Million Grant From National Cancer Institute

...e Harbor Branch grant will be used to evaluate the effectiveness of discodermolide on experimental models of human lung, breast and ovarian cancers and to isolate and evaluate both natural and synthetic, chemically related compounds (analogs) of discodermolide which may prove more effective than discodermolide its...

New Gene Alteration Find Points To Aggressive Leukemia Treatment

...heir retrospective study. Next, they will testthe effectiveness of aggressive therapy in patients with the ALL1 defect. Caligiuri suggests that a screening test for the defect, now availableat Ohio State, should be widely available this year. The international collaboration was funded by the Leukemia Societ...

Low Cholesterol? Reduced Sodium? What Do These Terms Really Mean?

...tritional information. This study investigated the effectiveness of these NLEA standards. The objective of this study was to investigate consumer perceptions of threecommon quantifier terms (reduced, low, and free) as seen on actual food labels.The study measured the quantity of four dietary components (fat, chol...

USGS Cautions Proper Use Of Pepper Spray To Avoid Bear Attacks

...rmation on research accepted forpublication on the effectiveness of red pepper spray as a bear deterrent inaggressive bear-human interactions fax Dr. S. Herrero in Calgary, Alberta,Canada, at 403-284-4399. S. Herrero and A. Higgins. 1998. Field use of capsicum spray as a beardeterrent. International Conference on...

Short-Course TB Prophylaxis Effective In HIV-Infected Individuals

...th HIV, but poor compliance limits the effectiveness of this regimen," explains Dr. Gordin, principal investigator at NIAIDs CPCRA Unit in Washington, D.C. In most clinical settings, he says, compliance rates for patients receiving INH to prevent disease typically are lower than...

Carnegie Mellon Researchers Say Direct Instruction, Rather Than "Discovery Learning" Is Best Way To Teach Process Skills In Science

...ing at Stanford University, Klahr has examined the effectiveness ofdifferent methods for teaching elementary school children the Control ofVariables Strategy -- one of the central process skills needed in scientificexperimentation. "Our work demonstrates that even preschool children can distingui...

Lactose-Intolerant People Should Drink More Milk, Expert Says

...earch studies on calcium metabolism have shown the effectiveness of this form of treatment, Savaiano says. "We've found that if you do controlled clinical blind trials, where people don't know what they are consuming, and you take out that placebo effect, you can give subjects a glass of milk with breakfast and an...

Reclaimed Waste Water Can Augment Municipal Drinking-Water Supplies But Concerns Must Be Addressed

...evel of viruses and parasites in all waters andthe effectiveness of both conventional and advanced water treatment processes inremoving these pathogens. The federal government should undertake populationstudies that compare the disease rates over time among individuals exposed toreclaimed water to the disease rat...

Cystic Fibrosis Foundation Launches Innovative Therapeutics Development Centers

...The final phase, which assesses the drug’s effectiveness in a large population of patients, will involve the CF Foundation’s full network of 113 accredited care centers across the country. Cystic fibrosis is a complex, fatal genetic disease that affects about 30,000 children and adults ...

New Gene Therapy Technique Results In 60 Percent Tumor Regression Rate

...re conductinganimal studies with T7 to measure its effectiveness on brain and skin cancers.While their studies have been successful, scientists at Progenitor are trying toimprove the efficiency of the technology and improve the product form forcommercial purposes, says Ralph Snodgrass, co-author of the study and v...

New Test Opens Window On Corrosive Free-Radical Activity In Individuals

...e highly reactivetypes of oxygen nor to assess the effectiveness of any countermeasures thatmight be taken. Now, University of Pennsylvania Medical Center scientists have developeda new test to accurately and noninvasively measure free-radical activity inindividuals. The method, detailed in the March 31 is...

Motivating Muscles: New UD Study Might Help People With Paralysis 'Stay Strong Longer'

...Macleod says. "This study is the first to show the effectiveness of avariable pulse pattern, and it's very exciting...imulation to a wide range ofpatients." To test the effectiveness of different pulse patterns, the UD researchers askedvolunteers to sit in a chair-like device called...

1 2 3 4 5 6 7 8 9 10

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue