Tag: "effectiveness" at biology news

Aspirin Decreases Genetic Mutations Associated With Inherited Colon Cancer

...underway is a clinical trial in Europe to studythe effectiveness of higher doses of aspirin in preventing hereditary colorectalcancer. Dr. Lynch, Dr. Fishel, and Dr. John Burn (University of Newcastle,England and leader of the European Study) are currently organizing theinternational hereditary colorectal cancer p...

Gene Therapy Animal Study Offers Hope For Some Neurodegenerative Diseases

...iving placebo injections. "We've demonstrated the effectiveness of these approaches by direct measurementof the reduction of the mutant RNA in the retina, in studies of the eye'sanatomy and in the ability of the eye to show better electrical functionfollowing therapy," said LaVail. Phase I clinical trials of the ...

Hyperforin Is A Key To St. John's Wort, Researchers Say

... St. John's Wort has a strong record of safety and effectiveness inEurope where it has been popular for over 15 yea... tablets should be taken three times daily.Optimal effectiveness has been shown in as little as two weeks with continueduse. For additional information on MO...

Ear Infection Complications On The Rise, University of Florida Researchers Report

...evelop," Antonellisaid. As antibiotics lose their effectiveness for treating infections, he warned,more and more children will be hospitalized to receive antibioticsintravenously and surgery may be needed. Thirty-four percent of patients inthe study needed surgery. "The possibility for life-threatening complicat...

New Anti-Microbial Agent Destroys Anthrax

...e, animals or the environment," Baker said. BCTP's effectiveness against anthrax spores is especially significant, ...d suffered no adverse effects. To determine BCTP's effectiveness at treating animals exposed to anthrax spores,Baker's research team subcutaneously injected mice wit...

Upcoming 'Century Of Biology' Given Head Start By NSF Plant Genome Research Program Grants

...for example,will involve enhancing the content and effectiveness of a maize genome database. Researchers will look at gene selection in maize, and link new information tothis database. These resources will provide for much greater efficiency inmapping and identifying the 50,000 to 80,000 genes of maize, say scien...

Penicillin Gets A "Checkmate" Against Antibiotic-Resistant Bacteria

...m" againstresistant bacteria. Penicillin's effectiveness as an antibiotic has diminished since itswidespread introduction in the 1940s, due to the ability of various bacteria todevelop resistance to the drug. Researchers at the University of Limerick inIreland have taken a major first step forward by deve...

New Contaminant Invades Arctic Air

...rs worldwide are looking for ways of increasingthe effectiveness of this biodegradation. Writing in the Nov. 1 issue of Environmental Science & Technology,Michigan State University scientists report the results of a study involving theaddition of iron sulfate to PCB contaminated sediments. The journal isp...

Researchers Make Breakthrough In Gene Transfer

...ther controls a foreign gene of choice. Totest the effectiveness of the vectors, the researchers tried out several foreigngenes, including luciferase, the enzyme that makes fireflies glow. Some of thegenes were expressed at high levels, even after the host cells had divided 30 to40 times. In unpublished w...

Viral Vector Delivers Dystophin Gene To Mouse Muscle

...'s dystrophin vectorcould be tested for safety and effectiveness in humans. Chamberlain and JerryMendell, M.D., of Ohio State University Medical Center, plan to begin testingthe vector for safety in humans in the spring of 1999. Dystrophin is a protein critical for normal maintenance of muscle tissue. Muscular d...

Arsenic Shown To Induce Cancer Remission

...eatment with arsenictrioxide appears to exceed the effectiveness of any single drug to treat APL,"said Dr. Steven S... the investigators will look at arsenic trioxide's effectiveness intreating other types of cancers....

USC Scientists Find That Multi-Vitamin Use And Hormone Replacement Therapy MayLower Levels Of Homocysteine

...older. The trial is primarily intended to trackthe effectiveness of Vitamin E in preventing atherosclerosis. According to one abstract Hodis presented last week, 190 regular multi-vitaminusers in his study had significantly lower homocysteine levels in their bloodand their arteries showed less arterial wall thicke...

Cardiac Clinical Trial Studies Use of Antibiotic In Preventing Heart Attack

...ies in Israel andthree in Europe, are testing the effectiveness of the common antibiotic,Azithromycin, in preventing recurrent heart attacks. "Of people who have just had a heart attack, 20 to 25 percent are likely to haveanother heart attack within the next six months," says Bojan Cercek, M.D.,Ph.D., Lead Inves...

LSU Agricultural Center Researchers Develop Termite Detection System

...n place, it wouldtake about a year to evaluate the effectiveness and efficiency of the system."...

New Findings On Receptor Regulation May Lead To Better Drugs For Diabetes

... In addition to offering a way to increase the effectiveness of TZDs, thediscovery that phosphorylation alters the binding of TZDs to PPAR-gamma couldrefine strategies for finding new diabetes medicines. The findings also raisethe possibility that PPAR-gamma receptors in different tissues and cell typesmay hav...

The UK Braces Itself For The Flu Season, Are You Looking Information On The Virus?

... per cent effective in preventinginfluenza - their effectiveness depends on a number of factors, such as the ageof the person vaccinated, the state of their immune system and the particularstrain of infecting virus. However, all those who are at risk should still bevaccinated on an annual basis to help decrease t...

Genetically Engineered Mice Exhibit Anxiety, Offering Insight Into Role Of Serotonin In Brain

... able to developmore selective drugs with improved effectiveness and fewer side effects," saidTecott. The mouse mod...aps, depression. It could also be usedto test the effectiveness of anxiety reducing, and, perhaps, antidepressant,compounds. The researchers' next step, said Tecot...

Oil Spill Cleanup Product Made From Sugar Byproduct

...er, Breitenbeck explains. They also maintain their effectiveness for a significant time after they'retreated with a...n, Breitenbeck is testing inoculantsto improve the effectiveness of the process. "Adding microbes to the materialcan improve the efficiency of the process, especial...

X-Ray Concentrator Will Expand Window On High-Energy Universe

...ch problems in our own laboratory with a speed and effectiveness neverbefore possible," Carter said. "These and future applications should have aprofound impact on many areas of science and medicine." Bending X-rays Capillary optics don't focus X-rays into images, but merely act as light guidesto concentrate...

Researchers Identify Molecular Site That Is Key To HIV's Ability To Infect Cells Of Brain, Colon

...ter. And this finding, he said, bodes well for the effectiveness of drugs (some ofwhich are in development) that could block the action of CCR5, as it suggeststhat tissue-specific HIV will not evolve to recognize other co-receptors, likeCXCR4 or CCR3. "A lot of companies wonder if drugs that block CCR5 will caus...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument