Tag: "embryogenesis" at biology news

EMAP II: A Cytokine Regulated By Apoptosis

...e expression pattern of the EMAP II gene during embryogenesis of the mouse and found that the EMAP II messenger-RNA (mRNA) is predominantly expressed at sites of tissue remodelling. Since it is known that programmed cell death is a necessary requirement for tissue remodelling, mouse embryos were ...

Quicker Implementation Of Research Results

... aims at exploring thestructure and control of the embryogenesis programme and the cellular andmolecular effects of oxidative stress. At the same time, scientists hope toidentify elements of the common molecular heritage of animal and plantorganisms. At the centre of excellence looking into "Motor systems " biolog...

Study Finds Protein Clues To Early Embryo Development

... proteins crucial to normal cell functioningduring embryogenesis and throughout the organism's life. About half of thenucleoprotein complex known as DNA are histone proteins. Although the new study looked at frog oocytes - largely because of theiraccessibility in large quantities - proteins structurally similar to...

Researchers Isolate Gene For Heart And Facial Defects

...tava."Dissection of a molecular pathway regulating embryogenesis in mice led to theidentification of a human disease gene. This study will help us to furtherunderstand the mechanisms that control cardiac and craniofacial development." Other UT Southwestern researchers participating in this study werepediatri...

New tool for comparative gene studies

... study developmental processes that occur early in embryogenesis need the genes to work for only a short time in order to test their theories. Patel has already used this technique to study the gene 'wingless' (wg) in Tribolium, or the red flour beetle. In Drosophila, the role of wg in segmentation has been we...

NYU biologist identifies gene that regulates how plant cells proliferate and organize to form root systems

...the evolution of meristem organization both during embryogenesis and vegetative growth."...

ASPB Annual Meeting, August 3-7, media tip sheet

... on functional analysis of LEAFY COTYLEDON1 during embryogenesis in Arabidopsis. Sier Ching Chantha, Institu de Recherche en Biologie Vegetale - Speaks on the plant NOTCHLESS homologue and its possible role in embryogenesis. Jane Shen-Miller, University of California, Los Angeles - Speaks concerning the offspring ...

Crucial gene found for embryonic stem cell maintenance

...sary for the normal progression of early mammalian embryogenesis and the establishment of embryonic stem cell lines. This work represents a significant advance in our understanding of the complex genetic framework that supports early mammalian development and stem cell pluripotency. Critical to the use of embryoni...

Knocking the Sox off early mammalian development

...ied a gene that is required during early mammalian embryogenesis to maintain cellular pluripotency the ability of an embryonic cell to develop into virtually any cell type of the adult animal. This discovery by Dr. Robin Lovell-Badge and colleagues at the MRC National Institute for Medical Research (London, UK) t...

Abnormal plant shows scientists path to plant, animal development

...gnated as lowercase pkl, was unable to repress the embryogenesis genes. The result is a plant that is dwarfed compared to a normal plant, has a pickle-shaped root, and characteristics of both an embryo and an adult plant. Ogas said they found that embryo-promoting genes are expressed at inappropriately high levels...

New mechanism for gene silencing identified

... in many human cancers these genes associated with embryogenesis are inappropriately reactivated, causing the explo...ntified a mechanism by which genes associated with embryogenesis are kept silent. Importantly, the silencing is heritable; that is, when a cell divides, its daughter...

Two worms are better than one

...hat shares essential features of human biologyfrom embryogenesis to agingC. elegans is a favorite subject for studying how genes control these processes. The way these genes work in worms helps scientists understand how diseases like cancer and Alzheimer's develop in humans when genes malfunction. With the publica...

Zebrafish model human development and disease

... helped biologists identify many genes involved in embryogenesis and, because it's a vertebrate animal, has become a valuable resource for identifying genes involved in human disease. Zebrafish are the focus of two research articles and an accompanying news feature in this issue of PLoS Biology. Thomas Bartman and...

Excess thyroid hormone harmful to fetus

... T[hyroid] H[ormone] excess can, by itself, impair embryogenesis of growing fetuses through transplacental passage of maternal TH.... Given the established importance of providing TH replacement to even mildly hypothyroid pregnant women, it is important to recognize that over-replacement appears to be equally det...

There and back again

...epithelial transitions (METs) are regulated in the embryogenesis of the chicken. The article, published in the September 14 issue of Developmental Cell, describes how a pair of intracellular molecules affects the ability of mesenchymal cells to convert into epithelial cells during the formation of somites early in...

1

(Date:11/23/2014)... BambooFlooringChina.com , the world’s leader in bamboo flooring, ... flooring collection. Now, the business is announcing big discounts ... promotion is valid until Dec. 20, 2014. , The new ... dust-free surface, which makes it very easy to maintain. As ... wants to make its website the best shopping platform for ...
(Date:11/22/2014)... (PRWEB) November 23, 2014 Cancer researchers ... a connection between intercellular communication tunnels and the growth ... the full story on the Surviving Mesothelioma website. ... and the University of Minnesota have just released their ... information and materials between cells. They found that ...
(Date:11/22/2014)... Recently, Locks-Magnetic.com , one of the successful electrical ... locks for glass doors online. In addition, the company ... products. Customers can get more information on its website. ... excellent performance. Customers who want to buy this new ... They also can enjoy the one-stop shopping experience. ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 “Due to ... said an inventor, from Gurnee, Ill. “While using the ice ... be and I thought there needed to be a safer ... invented the SPIKE BLOCK. , The SPIKE BLOCK offers added ... so, it would help to reduce injuries and damage associated ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 "My ... the pain caused by the machine," said an inventor ... she had to go back a second time because ... invention idea." , She developed the patent-pending MAMO EASY ... breast cancer. The design saves the patient from the ...
Breaking Medicine News(10 mins):Health News:Click Strand Woven Bamboo Flooring From Famous Bamboo Flooring Company BambooFlooringChina.com 2Health News:Study Links Cellular ‘Tunnels’ to Mesothelioma Proliferation, According to Surviving Mesothelioma 2Health News:Discounted Mag Locks for Glass Doors Revealed by Locks-Magnetic.com 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford