Tag: "epileptic" at biology news

Brain has center for detecting sound motion

...oved--using electrodes already in place to monitor epileptic activity. They found that such stimulation of the right posterior STG led the patient to report that "there was a humming sound coming toward [her] face." When the researchers presented moving sounds to the patient while they recorded from the electr...

Convulsions in worms mimic epileptic seizures

...he University of Alabama have found a way to mimic epileptic seizures in the tiny roundworm C. elegans. The finding could make the worm a powerful model for unraveling the molecular regulation of epilepsy, a condition that affects two percent of the population. Guy A. Caldwell, coordinator of the Howard Hughes...

Epilepsy: Signals 'brake' in brain impaired

...rch team from Marseilles discovered in the case of epileptic rats that the signal processing is not only affected in the synapses but also in the neurons themselves. The nerve cells are surrounded by a cell membrane. Yet this membrane is not impervious: different kinds of specialised pores ensure that specific...

Loss of circadian genes results in epilepsy

...animals died as a consequence of the sound-induced epileptic attacks. In contrast, none of the DBP/HLF double k...mice lacking all three PAR bZip genes are prone to epileptic seizures. The recording of electroencephalograms (EEGs) during several days revealed that all of the...

Bim notes in the neuronal executioner's song

...nged seizures as well as after brief or repetitive epileptic seizures. Previous work has indicated that loss o...uronal damage. Of interest, in the hippocampus of epileptic patients, Bim appeared to be selectively down-regulated. These results suggest a means by which the...

JCI table of contents, 2 April 2004

...nged seizures as well as after brief or repetitive epileptic seizures. Previous work has indicated that loss o...uronal damage. Of interest, in the hippocampus of epileptic patients, Bim appeared to be selectively down-regulated. These results suggest a means by which the...

Study points to new gene therapy tool in preventing epileptic seizures

...cent of the U.S. population. A large proportion of epileptic adults have temporal lobe epilepsy, which is often very difficult to treat, and for about 30 percent of those individuals the only treatment option is surgery," said study co-author Dr. Thomas J. McCown, associate professor of psychiatry in UNC's Sch...

From biology to computing and back again

...evolution, the causes of asthma, the prediction of epileptic seizures, the uptake of carbon dioxide by forests, and, in vertebrates, the ability of cells to "self-organize" into tissues and the mechanisms that create limbs. The participants are also examining efforts to add mathematical-modeling exercises int...

Pennsylvania chemist wins national award for drug research

...eat disorders, including topiramate for preventing epileptic seizures. He will receive the 2003 Award in Indust...n more than 70 countries to treat various types of epileptic seizures, he said, but it also shows promise in treating other disorders of the central nervous syst...

Canadian scientists unlock secret of calcium waves in cells

... epilepsy, since mice lacking IP3 receptors suffer epileptic seizures and improper brain function. The scientists examined the atomic structure of the IP3 molecule and its receptor, and now know exactly how they bind together. Having an accurate 3D picture of the molecule-receptor interaction may aid in the d...

Surprise, surprise, surprise: Hopkins scientists unexpectedly create epilepsy in rats

...e course of 10 days, their GABA levels dropped and epileptic symptoms developed, says Rothstein. "We've... time as freezing and staring episodes - "textbook epileptic seizures," says Rothstein. "Despite recognizing that glutamate and GABA have the same functions in ...

Mouse model mimics natural development of epilepsy

...han half of whom experience frequent, debilitating epileptic seizures. TSC also causes tumors to form in various organs, including the brain. Physicians cannot cure the disease nor can they predict which individuals will experience severe symptoms. Scientists have identified two genes responsible for TSC TSC...

Anticonvulsant drugs found to impact on epileptic childrens ability to recall information

...effects of drugs on the cognitive functions of the epileptic child, they relied on three established postulates...comparable organism lacking this experience. With epileptic children, that experience may be the use of anticonvulsant drugs. Accordingly, a research effort fro...

Neural stem cells move to damaged areas of brain after injury

...of his experiments with laboratory rats. Prolonged epileptic seizures or strokes in these rats caused neural pr...never develop into neurons, Parent adds. Prolonged epileptic seizures cause widespread, diffuse damage to neurons in the brains hippocampus and other parts of th...

Preventing overload in the brain

...e brain does not 'crash', as is the case during an epileptic seizure. The neurobiologists from the University ... the importance of not being overloaded. During an epileptic seizure, the brain (including the hippocampus) becomes disorganised and all of the pyramidal cells f...

Anti-depression 'pacemaker' demonstrates long-term benefits

...ectrical stimulation of the vagus nerve could stop epileptic seizures, he founded Cyberonics, which developed the VNS device. It was approved for treatment of severe epilepsy in Europe in 1994 and in the U.S. in 1997, and now has been implanted in more than 14,000 epilepsy patients worldwide. Because of anecdo...

New epilepsy gene identified in mice

...e that is mutated in mice that develop spontaneous epileptic seizures in response to loud noises. The brain protein affected by the mutation is unlike any other known to cause epilepsy in mice or humans. In an article published in the August 30, 2001, issue of the journal Neuron, a research team led by Howard ...

Scientists at Penn track epileptic seizures

.... The work points toward a method to short-circuit epileptic seizures and convulsions before they strike, throu...s discovered cycles of abnormal brain activity -- epileptic discharges -- lasting 15 to 30 minutes. The discharges became more frequent over a period of hours a...

Potent new compound from blue-green algae may help treat, elucidate nerve disorders

...erestingly, drugs such as topiramate help suppress epileptic attacks largely by blocking sodium channels. Such painkillers as lidocaine are sodium-channel blockers as well. "These disorders, including neurodegenerative diseases, could be treated by selectively activating and blocking sodium channels," said Ger...

Vanderbilt neuroscientists identify 'oops center' in the brain

...the 1940s by neurosurgeons exploring the brains of epileptic patients. Previous research by Schall and others had shown that an area nearby, called the frontal eye field, exercised direct control over eye movements. The researchers knew the supplementary eye field also had some involvement in the control of ey...

1 2

(Date:8/22/2014)... (PRWEB) August 22, 2014 A new, online ... connection. The summit is no-cost and open to everyone. ... kept secrets, practical tips and advice on how to stop ... or manage weight. Mindful eating is not a diet. ... stay motivated instead of an "eat this, don't eat that" ...
(Date:8/22/2014)... who need surgery for facial pain caused by trigeminal ... used, reports a study in the September issue of ... Congress of Neurological Surgeons . The journal is ... part of Wolters Kluwer Health . , Percutaneous ... lower cost than other types of surgical treatments for ...
(Date:8/22/2014)... Ticket Down is a reliable source for ... Albuquerque and Rapid City. For fans looking to speak with ... allows just that. Caputo was born and raised in Hicksville, ... knit family who began to see spirits when she was ... had a chance to do what most people wished they ...
(Date:8/22/2014)... 2014 Pirate Jonny's Caribbean ... in providing new recipe cards, fun t-shirts, and caps ... Hailing from Clearwater, Florida, Pirate Jonny, aka, Jonathan Toner, ... with two to three recipes featuring different flavors of ... on the website. The recipe cards will feature ...
(Date:8/22/2014)... According to the new research ... Global Trends & Forecast to 2019" defines and ... forecast of the market value. The isocyanate material ... 2019, at a significant CAGR from 2014 to ... 44 figures spread through 286 pages and in-depth ...
Breaking Medicine News(10 mins):Health News:20 Top Experts Discuss How to Unravel the Food-Mood Connection 2Health News:More common procedures for painful facial tics carry high costs, reports study in Neurosurgery 2Health News:Theresa Caputo Tickets in Kalamazoo at Wings Stadium, Saenger Theatre in New Orleans, Kiva Auditorium in Albuquerque and Rapid City at Don Barnett Arena Now Available 2Health News:Pirate Jonny's Caribbean BBQ Rubs, Seasonings & Sauces Get New Look by Hoisting New Recipe Card Creations and New Clothing Apparel for its Logos 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 3Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills