Tag: "exit" at biology news

Viral proteins may prevent bacterial infections

...o bacterial cells, copy themselves and then, as an exit strategy, produce enzymes that quickly destroy the bacterial cell wall, killing the bacteria and releasing the viral offspring. "These are highly evolved enzymes that work efficiently and rapidly to kill specific bacteria. The best use of these enz...

Commercialization deal boosts hope for new sickle-cell drug

... Gardos channel, through which potassium and water exit the cell. Blockade of this channel keeps the cells hydrated, resulting in much less sickling. The CHB researchers also discovered that clotrimazole has metabolites (breakdown products) that can reduce sickling without the liver toxicity and o...

Researchers in UGA Vet School discover a mechanism that blocks replication of a retrovirus

...th the cancer-causing retrovirus JSRV's ability to exit host cells. The blocked escape route is attributed mainly to a single amino acid substitution in a protein that comprises the virus's protective shell. Other scientists have reported endogenous retroviruses that interfere with infective retrovirus r...

New insight into cancer metastasis

...migrate through the bloodstream to a distant site, exit the bloodstream, and establish new colonies. The entire operation involves so many steps that it raises an obvious question: How do cancer cells cobble these behaviors together and acquire the ability to do all this? According to the new study, they ...

'Cardiofunk' mutation: Probable source of congenital heart defects

...e ability to develop a valve required for blood to exit the heart. Normally, blood is pumped from the atrium to the ventricle; then the valve between them closes so that when the ventricle contracts, blood flows forward into the embryo's circulatory system instead of backward into the atrium. But in the m...

U of T researchers isolate gene for Crohn's disease

...ell surface and regulates how substances enter and exit the cell. In a majority of Crohn's disease patients, this protein functions improperly and allows toxins easier access to the cell. The ability to test for this protein malfunction will help physicians distinguish between Crohn's disease and ulcerat...

Workshop for new synchrotron light source at Brookhaven

...York. The Laboratory is located 1.5 miles north of exit 68 on the Long Island Expressway. DETAILS: NSLS-II is a proposed new advanced, third-generation, medium-energy electron storage ring that will produce X-rays 10,000 times brighter than the current National Synchrotron Light Source (NSLS) at Brookha...

Calcium channel involved in coronary artery relaxation

... channel. When these channels open, potassium ions exit the cell, triggering an inhibition of contraction. "We propose that the calcium influx from the T-type channel triggers the potassium channel to open and that is how this calcium channel is involved in relaxation. Without it, the smooth muscle is no...

Workshop takes 'systems' view of information processing in organisms

...her direction on the Capitol Beltway (I-495), take exit 34 (Wisconsin Ave.) and continue 1.5 miles south; the hotel will be on the right. When: 8:15 a.m. to 5:50 p.m., Tuesday, Nov. 4; and 8:30 a.m. to 5:20 p.m., Wednesday, Nov. 5. For more information: NSF Media Contact: Sean Kearns, 703-292-7963, s...

First structure of transporter enzyme family is solved

...pers by controlling the entry of nutrients and the exit of waste products. But only four transport protein structures are presently known, compared with over 30,000 soluble protein structures, because they are notoriously difficult to crystallise. Professor Iwata's Laboratory of Membrane Protein Crystallo...

New technique for sorting sperm could improve fertility treatment

...rm were able to cross over to the other stream and exit through the second channel, while the nonmotile sp...d by gravity and surface tension. The motile sperm exit a different outlet than non-motile components because motile sperm can swim and cross streamlines," ...

Researchers view protein's structural changes in real time

...at change the pathway that carbon monoxide uses to exit the protein, which could benefit the development of artificial blood substitutes by enhancing the rate at which oxygen is released while slowing down its reaction with other gas molecules. "The real-time pictures of carbon monoxide migrating through ...

15-foot hypodermic needles provide evidence for vast oceanic crustal biosphere

...nt chemical environments, have unique entrance and exit ports and would have been exposed to completely different formation histories. "It's like finding an undiscovered world."...

The human eye can self-correct some optical faults

...are reflected back through the internal optics and exit the eye, the wavefront analyzer measures and computes deviations from a perfectly formed light beam or test pattern a short distance in front of the eye. Light rays exiting an optically perfect eye should be perfectly parallel, but irregularities in...

Male groundhogs hibernate less to visit the ladies

... food availability." Typically, groundhogs do not exit hibernation for good until early March, which is when they mate. These episodes of early visitation occur in February. It does not appear that mating occurs during these early encounters. "The length of the hibernation season at a given location...

Mathematical prediction of on-off switches in cell division proven

...isted. To turn the switch OFF (inactivate Cdc2 and exit mitosis), required cyclin levels to drop to 16 units or less. These experiments demonstrated that the control system is bi-stable and hysteretic. What regulates these irreversible switches has been a big question, Sible explains. "Others have publish...

Clock cues: Cellular sensing, metabolism research wins Amersham Biosciences and Science Prize

...mutants within a group of genes called the mitotic exit network (MEN), Shou concluded that MEN controls the end of cell division by transmitting a signal to dismantle a protein complex dubbed RENT, which keeps the cell from ending mitosis prematurely. Shou, now at Rockefeller University, submitted two ess...

Study of menopausal women finds no benefit from hormone therapy and antioxidant vitamins

...erformed when women entered the study and at study exit approximately 3 years later. During the trial, participants visited their clinics at 6 and 12 month intervals to undergo symptom and quality of life assessment and a comprehensive series of diagnostic tests, including blood pressure, pap smear, and ...

Nutritional supplements may combat muscle loss

...determine the amount of amino acids that enter and exit the leg. "If 80 amino acids are coming into the artery and 60 are going out of the vein, we know that 20 were probably made into proteins in the muscle," said Dr. Douglas Paddon-Jones, also of UTMB and a co-investigator performing these studies. "We...

What inspires yeast cells to divide?

...these events have transpired without error will it exit mitosis and divide into two daughter cells. At thi...o destroy certain cyclins, which then forces it to exit mitosis and begin division. In both human and yeast cells, there are two oscillators: the Cdc20 osci...

1 2 3

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument