Tag: "extracting" at biology news

Scientists to examine DNA of George Washington trees

...e scientists will immediately begin the process of extracting DNA for detailed analysis. According to Hipkins, each samples genetic markers will be generated at multiple locations along the string of genetic information thought to show variation within a species. This information can be used to identify a sampl...

Ethiopian fossil skull indicates Homo erectus was single, widespread species 1 million years ago

... Ababa, where the UC Berkeley team spent two years extracting it from the encrusting rock matrix. White was disappointed to find that the lower face was gone. Because of peculiar scratches on the skull, he thinks the individual may have been killed by a large lion or hyena, which probably ate the face and gnawe...

Imagine no restrictions on fossil-fuel usage and no global warming

...y are studying a simple, cost effective method for extracting carbon dioxide directly from the air - which could allow sustained use of fossil fuels while avoiding potential global climate change. The method would allow researchers to harvest carbon dioxide from the air, reducing buildup of the so-called "gree...

Industry explores renewable resources, such as lignin

...." Glasser has worked with lignin for a long time, extracting it from wood and agricultural harvesting residues and from paper-making waste. He has engineered materials from it, working on the molecular level, and has patents for applications ranging from biomedical materials to household items. Now he has team...

The 'forbidden' questions on genetic testing

...st stage of the research Dr Prior and the team are extracting anonymous data on families affected by certain inherited diseases which develop in adult life. They range from Huntington's disease, which is normally fatal, to conditions, which lead to colon cancer, which is highly treatable. Some people do not eve...

MIT technique could improve cartilage repair

...ation for repairing cartilage defects. It involves extracting a small amount of cartilage cells from a patient, coaxing them to multiply outside the body, and then implanting the new cells into the damaged area. But the procedure "is expensive, with a total cost of around $30,000," Grodzinsky said, "and it does...

Additive that makes juices 'tart' quadruples yield of essential hemophilia treatment

... bleeding," Shanbrom said. "But current methods of extracting the proteins from blood plasma don't produce enough clotting factor. New therapies involve going through the contortions of using recombinant DNA to produce proteins from Chinese hamster ovary cells and purifying them in mouse cancer cells. These the...

Maize's starch pathway found limited

...rom its wild relative, teosinte; searching for and extracting important genetic material from Latin or South American maize; or using transgenics, or genetic engineering. Each possibility's rewards come with risks, however. Teosinte's yield is not very high, so crossing it with maize would not be immediately u...

Sandia-aided method to heal wounded and diseased achieves US government acceptance

...liminate the need for freestanding oxygen tanks by extracting oxygen directly from the atmosphere. The Sandia research team was led by Mark Vaughn and Keith Miller. Sandia and Numotech each hold patents on the sensors and the Numobag, respectively, the result of their work under Sandia's cooperative research an...

New England lakes hold clues to lurking storms and floods

...h diameter PVC pipe to the bottom of the lakes and extracting core samples that were later sliced, photographed and painstakingly analyzed. "In each of the cores we looked for sandy layers of sediment that were washed into the lakes during rainstorm-induced floods," Noren explains. During "nor'easters," cyclon...

Scientists discover ancient protein and DNA sequences in the same fossil

... changing shape. According to Nielsen-Marsh, "By extracting biochemical information from fossils, scientists utilize tools that avoid these difficulties and offer more objective comparisons between ancient and modern species." This approach could possibly unearth new knowledge about evolutionary relationship...

Squirrels' evolutionary 'family tree' reveals major influence of climate, geology

...ory museums that agreed to let the researchers try extracting DNA from preserved remains. "Some of these squirrels are really rare," he added. "They're not only difficult to find in their natural settings. They're rare in museums." Sensitive to the possibility that museum specimens' DNA might be degraded or co...

New immune-boosting cancer treatment shows promise

... ovarian cancer had received a vaccine produced by extracting their own cancer cells, engineering the cells to produce the immune-stimulating molecule, granulocyte-macrophage-colony-stimulating factor (GM-CSF), and vaccinating the patients with those cells. This vaccine was developed by Dranoff and his colleagu...

Computational method identifies genes that regulate cell's machinery

...e Koller, they developed a new computer method for extracting regulatory circuits from large collections of gene expression measurements. Friedman and Koller applied this method to experimental data from Saccharomyces cerevisiae, one of the primary model organisms in genetics. The method identified modules of ...

Bacteria convert food processing waste to hydrogen

...ity via fuel cells at close to 80% efficiency. "By extracting hydrogen and methane from their wastewaters, these plants can also reap significant savings by not needing to aerate. Aeration makes up 20 to 80 percent of wastewater treatment costs." Van Ginkel presented the Penn State team's findings in a poster,...

Researchers aim to centralize N.C. emergency room data to combat epidemics, bioterrorism

... has been to design technical solutions capable of extracting needed data quickly with minimal impact on hospital staff, transmitting it securely and standardizing data from different hospitals. Another key aspect will be learning from similar activities taking place in other states and sharing nationally what ...

DFG to establish nine new collaborative research centres

...his approach aims to lay important foundations for extracting and optimising novel active substances with which infectious diseases can be combated. Speaker: Prof. Dr. Gerhard Bringmann, University of Wrzburg, Tel.: 0931/888 5323 The Collaborative Research Centre on "Solid-Based Quantum Information Processing: ...

Cancer could be caught before it develops

...Medicine's Unified Medical Language System (UMLS), extracting all of the terms relating to precancers from the 'Metathesaurus', and adding an additional 10% from their own knowledge. They identified 568 distinct precancer 'concepts', which have been described by over 4700 terms. Often one precancer is described...

Breast fluid a better option for detecting cancer

RICHLAND, Wash. - A new method of extracting and analyzing fluid from a woman's breast may provide a more accurate, less expensive and noninvasive way to determine a patient's risk for breast cancer or to diagnose the disease in its early stages. In a paper published in the July 3 issue of Brea...

Researchers find mechanism that may determine early blood cell fate

...ents. Today, a growing number of hematologists are extracting HSC much more easily from peripheral blood or umbilical cord blood. But since fewer cells are present in these sources, it would be advantageous to expand the cells to increase their numbers, explained Emery Bresnick, UW Medical School professor of p...

1 2 3

(Date:12/20/2014)... 20, 2014 Parker & Sons, Inc. ... years of experience in contractor services announces reaching a ... for the homeowners of Arizona. Parker and Sons is ... contractor technicians that make customer service the number one ... Arizona and started with one service vehicle and has ...
(Date:12/19/2014)... (PRWEB) December 19, 2014 Sub Zero Ice ... sponsor a blood drive Sunday the 28th from 2pm-6pm at ... & Sawyer Road in Sarasota, FL. , Inquiries regarding time ... you for participating in the donating process, Sub Zero Ice ... flash frozen, custom ice cream. , About Sub Zero Ice ...
(Date:12/19/2014)... 2014 Eufaula, Oklahoma, located just 9 ... the state’s largest lake with more than 600 miles ... to a little more than 3,000 residents, hosted its ... the 6th of December. , Featuring Santa, Christmas lights ... Eufaula on Main Street. Narconon Arrowhead’s parade float ...
(Date:12/19/2014)... warns parents that buying an older car for their teens may ... drivers killed in the United States between 2008 and 2012 were ... lacked important safety features that are available on newer cars, the ... were in cars at least six years old, 34 percent were ... cars 11 to 15 years old, and 17 percent were in ...
(Date:12/19/2014)... 2014 (HealthDay News) -- Dense bunches of bacteria called biofilms ... new study finds. The researchers said these biofilms ... The presence of these biofilms may represent an increased ... to predict a person,s risk for the disease, the researchers ... these biofilms may coat the mucus layer of cells lining ...
Breaking Medicine News(10 mins):Health News:Parker & Sons Announces Reaching A Milestone By Providing 40 Years Of Dedicated Contractor Services For Homeowners Of Arizona 2Health News:Parker & Sons Announces Reaching A Milestone By Providing 40 Years Of Dedicated Contractor Services For Homeowners Of Arizona 3Health News:Shark Tank’s Sub Zero Ice Cream Sponsors Blood Drive 2Health News:Narconon Arrowhead Debuts Float at Checotah and Eufaula Christmas Parades 2Health News:Narconon Arrowhead Debuts Float at Checotah and Eufaula Christmas Parades 3Health News:Older Cars a Bad Choice for Younger Drivers 2Health News:Could Bacteria Play a Role in Colon Cancer? 2
Other Tags
interfacebalancelonglinecasualtiesadversarycommerciallymirrorcletarcevashuntsalertssilenceamplifymetalsthinksvolunteersfully