Tag: "extracting" at biology news

Ancient DNA analysis unveils mystery of history's most horribly deformed man -- The Elephant Man

...ime ever, scientists were incredibly successful in extracting DNA from Joseph Merrick's century-old hair and bone in their investigation of his condition. In addition, descendants of the Elephant Man's family, many who didn't even know they were related to him, were reunited. While it was considered that...

$9.4 million NSF grant backs UCSB-led effort in bio-image informatics

...nformation processing technologies appropriate for extracting detailed understanding of biological processes from images depicting the distribution of biological molecules within cells or tissues." Said Feinstein, "Not only do we now analyze those images one at a time by eye, but there's also no way to sort thr...

PNNL wins record $10.2 million NIH grant for proteomics center

...mproved computational and bioinformatics tools for extracting and visualizing and ultimately understanding the data produced in the resource center, Smith said. The research creates quantities of data that in many cases can be analyzed only with computer programs developed specifically for that purpose. Like ...

University of Minnesota receives NSF grant to sequence legume genome

.... Bioinformatics is the discipline that deals with extracting useful information from reams of data, such as is generated in any sequencing project. Roe and Town will lead the actual DNA sequencing work, which will be performed at highly specialized robotic facilities at Oklahoma and TIGR. The Minnesota-led pro...

Bad Mileage: 98 tons of plants per gallon

...and natural gas. Then he studied the efficiency of extracting such deposits. During each of the above steps, he based his calculations on previously published studies. The calculations showed that roughly one-eleventh of the carbon in the plants deposited in peat bogs ends up as coal, and that only one-10,750t...

UN report: Accelerate global agreement to oversee exploitation of South Pole 'extremophiles'

...nments. Many scientists believe that isolating and extracting the substances that allow these organisms to prosper could have enormous implications in biotechnology research, possibly leading to new cancer treatment drugs, antibiotics and industrial compounds. But in fragile Antarctica this optimism is offset b...

Microbial biofilm yields community genomes, metabolic clues

...al species-"randomshotgun sequencing." This meant extracting DNA directly from the sample and a"small insert library." Once the sequences of short pieces of DNA were obtained, computer processing linked them to generate large genomicfragments that could be assigned to specific organismswithin the community. T...

Scientists develop plant that produces potential anti-carcinogen

... first method, called mass spectroscopy, relies on extracting compounds from the plant tissue using a variety of solvents, then running those compounds through a type of machine that identifies their chemical nature. The other method they used is called x-ray absorbance spectroscopy, or XAS. This technique...

Algorithms help diagnose cancer

...n within a sample of blood, and Q5 is one means of extracting new and important data. "Most exciting to us, unlike previous mass spec disease diagnosis methods, Q5 provides clues about the molecular identities of abnormal proteins and peptides, which often cause disease. These altered proteins can serve as biom...

Experiments establish 'protein-only' nature of prion infections

...eneration to generation. Finally, they showed that extracting prion protein from subsequent generations of yeast cells yielded protein with the same properties as the strain with which the cells had originally been infected. Weissman said that the ability to generate, manipulate and study distinct prion strains...

Oil exploitation in Ecuador's Amazon basin produces a 'public health emergency'

...so available in Spanish . Exploring for oil and extracting it from the Amazon region of northeastern Ecuador has boosted the country's income over the last several decades, but it has also resulted in a "public health emergency" due to the negative effects on the local environment and on the health of person...

Young chimpanzees show sex differences in learning

...r termites successfully. On average, females began extracting termites on their tools at 31 months of age, males at 58 months. In young animals that had already acquired the skill, females fished more often and caught more termites each time they dipped a stick into a termite mound. Females also paid closer att...

Kinase backgrounder: Iressa discovery part of major kinase project at Dana-Farber

...er for Genome Research, Dana-Farber scientists are extracting it from tumor samples, checking for quality, isolating the kinase gene segments of interest, and preparing them to be deciphered by the Whitehead robots. Much of this work is performed in Sellers' laboratory by postdoctoral fellow Guillermo Paez, PhD...

Access to DNA secrets yields better understanding of genes, possible tool for disease diagnosis

...ch genes are turned on, or expressed, in a cell by extracting RNA and measuring how much of it is being produced for each gene. An RNA microarray, or "gene chip," is the standard equipment used to measure RNA expression levels. "Only a small fraction of genes are making sufficient RNA to be detected with RNA mi...

Comparing primate genomes offers insight into human evolution

...he genomic era, as scientists become more adept at extracting biological meaning from an ever expanding repository of sequenced genomes, it is likely that our next of kin will again hold promising clues to our own identity. Comparing primate genomes is an approach that can help scientists understand the genetic...

Identifying tick genes could halt disease, bioterrorism threat

...equencing project, she said. She already has begun extracting RNA from ticks at different stages of their lifecycle and from different tissues in the tick. These samples will provide the scientists with the first clues as to the types of genes present in ticks and how gene expression changes when ticks are infe...

$18 million bioinformatics center to become weapon against deadly diseases

...s (PUMA, WIT, ERGO and the SEED), is interested in extracting deeper understanding from analysis of the growing body of genomic data. In 2003 he co-founded the Fellowship for Interpretation of Genomes. Among the scientists who will directly benefit from the data center will be the eight new Regional Centers of ...

Molecular motor implicated in tissue remodeling

...ular motors in the extracellular matrix operate by extracting energy from the very track they move upon." The researchers propose that the molecular motor contributes to restructuring the extracellular support matrix during tissue growth and development or wound repair or even during cancerous invasion of tissu...

1 2 3

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting