Tag: "feeling" at biology news

Study shows brain activity influences immune function

...em feel intensely happy and another that left them feeling intensely sad, fearful or angry. As the respondents focused on the emotion experienced for one minute, the researchers measured the electrical activity in both the right and left sides of the prefrontal cortex. Previous studies, notes Davidson, have...

Researchers identify genes that may be associated with prognosis in pediatric leukemia

...ther symptoms similar to those of the flu, such as feeling weak or tired all the time, with aching bones or joints. According to the American Cancer Society, an estimated 10,500 new cases of AML (both pediatric and adult) will be diagnosed in 2003, and an estimated 7,800 children and adults will die of the d...

UC Berkeley museum biologists to repeat 85-year-old Yosemite National Park wildlife survey

...ime when the park's unique and fragile habitat was feeling the pressure of increasing tourism. His survey led to recommendations for managing and preserving the park, among them, elimination of agriculture and removal of a small zoo from the valley. Yosemite's Thompson said he keeps a copy of Grinnell's pub...

Researchers find three chromosomal areas with links to alcoholism vulnerability

...to cause this effect." "All behavior, thinking and feeling are controlled by the actions of molecules in the brain," added Ivan Diamond, professor and Vice Chairman of the department of neurology at the University of California, San Francisco. "Brain molecules can be changed by experiences in our environmen...

Breast fluid a better option for detecting cancer

...ovington said. "Current detection methods rely on feeling a lump in a self-exam or visualizing a lump in a mammogram. By the time a lump has formed, the cancer has progressed. My technique, combined with Battelle's protein analysis capabilities, makes our approach one of the leading methods for identifyin...

Surrogate mothers have no doubts about handing over the baby

...al bond with the child. None of the women reported feeling that the child was like their own." Although aroun...ng with time. One year on, only two women reported feeling occasionally upset. Thus there was no evidence of difficulties with respect to those aspects of surr...

Graduate student Kristine Preston wins competition for A. Brazier Howell Award

...r Howell Award," said Preston. "It is a wonderful feeling to know that professionals in my field considered my work worthy of the award. I consider this an important professional achievement. Receiving this award reflects how much I have benefited from the support and advice of my advisor, Dr. John Rotenb...

Many pregnant women may have depression, but few getting treatment, study finds

...n, and encourage them to be open about how they're feeling during pregnancy and after delivery, rather than feeling guilty and embarrassed." The U-M Depression Center, the nation's only comprehensive center for depre...

UC Riverside's department of biology receives $953,000 GAANN grant

..." said Hammond. "Students left the GAANN training feeling as if they were simultaneously allowed to pursue their research while also becoming more well educated about important issues in biology that span many different disciplines. We found that the students also left with a much greater awareness of the ...

UI researchers discover new cause of muscular dystrophies

...pbell said. "What is really exciting for me is the feeling that this is just a little hint of a much bigger picture." In addition to Campbell, the UI researchers included Dimple Bansal, a graduate student in Campbell's laboratory and the lead author of the paper, Severine Groh, Ph.D., and Chien-Chang Chen, P...

Pheromones in male perspiration reduce women's tension, alter hormone response

...scale. "Much to our surprise, the women reported feeling less tense and more relaxed during exposure to the...he regimen was reversed. The women did not report feeling any more or less energetic, sensuous, tired, calm, sexy, anxious, fatigued or active after exposure ...

'Sleep debts' accrue when nightly sleep totals six hours or fewer

...at chronically sleep-deprived individuals reported feeling "only slightly sleepy" even when their performance was at its worst during standard psychological testing. The results provide scientific insight into the daily challenges that confront military personnel, residents and on-call doctors and surgeons, ...

High-risk women welcome genetic testing for breast cancer gene

...lies, and waiting to see whom it strikes next, and feeling helpless," said James C. Coyne, PhD, Professor of Psychiatry and Director of the Division of Behavioral Oncology at Penn. "In fact, in many cases the decision to pursue genetic testing may be a healthful and constructive way to cope with the threat ...

Pain and the brain: Sex, hormones & genetics affect brain's pain control system

...tion in endorphin release. The women also reported feeling more intense pain, and more pain-related negative emotions, than the men. Zubieta notes that all the women were studied at a time in their menstrual cycle when levels of estrogen and progesterone were lowest. This gender difference in pain response ...

Obesity not a personal failing, but a battle against biology

...y the compulsion to breathe," notes Friedman. "The feeling of hunger is intense and, if not as potent as the ...old water when their lips are parched? This is the feeling the obese must resist after they have lost a significant amount of weight. "The power of this drive...

Science's top ten: Discovery of genes' 'control switches' named top advance of 2002

...sed to cold temperature or menthol, triggering the feeling of coolness. The discovery of a heat-sensing channel in skin cells suggested that warmth is sensed first by the skin itself, which then notifies the nervous system. A third channel may produce a different sort of heat, at least in the male mouse nose...

'Scientific balancing act' dominates AAAS top ten list of science policy stories for 2002

...erous pathogens, scientists around the globe began feeling the impacts of new American security policies in 2002. While protecting the nation from terrorists is clearly the top priority, some of the new security policies may ultimately make us less secure by weakening science and hindering advances that bene...

Increased fiber curbs appetite in women

...addition of fiber to a mealcan increase a person's feeling of being full," said BarbaraSchneeman, a UC Davis nutrition professor, who led the study."It appears this is due not only to fiber creating a greatervolume of food in the gastrointestinal tract, but also tofiber promoting the release of cholecystokin...

Researchers: Protein family key to helping plants adapt

...th and flowering time. "It's become the prevailing feeling that when a plant senses its environment and signals to provide defense, the process turns on and off a number of different signal pathways that ultimately control the expression of specific genes that are required for adaptation," said Hasegawa, a h...

New insight into fragile X syndrome: Scientists identify possible link to RNAi

... involve an RNAi-related process. "It has been our feeling since we became involved in the field several years ago that only through an understanding of the mechanism of RNAi would we be able to understand the biological implications of this process," states Dr. Hannon. Fragile X syndrome is the most common...

1 2 3 4 5 6

(Date:8/29/2014)... August 29, 2014 According to these recent ... of Herpes and HPV cases in the last few years. ... the nature of these infections and the symptoms that make ... an STD. While some people aren't aware of the exact ... infections.” , The steady increase in the number of cases ...
(Date:8/29/2014)... August 29, 2014 How can ... proposition and provide top notch services. Dr. Michael ... practice by partnering with a double board certified ... launching two new websites! , Dr. Fiorillo’s services ... face surgical procedures. Some of these are breast ...
(Date:8/29/2014)... Today, Fecbek, a well-known female boots manufacturer and retailer, has ... The new items are offered in many styles, including sexy ... these products are nice-looking and elegant with the latest styles. ... , A boot is a type of footwear and a ... and the ankle and extend up the leg, sometimes as ...
(Date:8/29/2014)... Today, Progene reaches another milestone as the only testosterone ... healthcare network , but also with enrolled providers nationwide who ... few weeks ago. Today, we’re now recommended by healthcare ... , The network adds an unprecedented level of service to ... and after they make a purchase -- with the best ...
(Date:8/29/2014)... York, ON (PRWEB) August 29, 2014 Most ... professional needs to find a break in their day to ... always easy for business professionals to find a few hours ... announcement by North York Dental so important. It is now ... care that they need. , What is happening? , North ...
Breaking Medicine News(10 mins):Health News:It was reported that the Number on PositiveSingles.dating increased about 20% in 2014 2Health News:Michael Fiorillo’s Advanced Plastic Surgery Center Expansion – New Vein Specialist and Websites Launch 2Health News:Michael Fiorillo’s Advanced Plastic Surgery Center Expansion – New Vein Specialist and Websites Launch 3Health News:Nice Boots for Sale at Fecbek.com 2Health News:Progene Is Doctor Recommended Nationwide 2Health News:Progene Is Doctor Recommended Nationwide 3Health News:North York Dental Provides Dental Services to Busy Professionals 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes