Tag: "fellows" at biology news

EMBO supports restart of six female scientists at the bench

The first six fellows to benefit from the European Molecular Biology Organization's (EMBO) new restart fellowship scheme are preparing to start work in their laboratories. The selected researchers come from Germany, Hungary, the UK and Italy. They will restart their resea...

Researchers discover novel function of gene often associated with cancer

...elissa D. Adams and Mitch McVey, both postdoctoral fellows in biology, and Dr. Jeff J. Sekelsky, assistant professor of biology and a faculty member with the UNC Program in Molecular Biology and Biotechnology. McVey is a participant in UNC's SPIRE (Seeding Postdoctoral Innovators in Research and Education) P...

Wolf Prize shared by Texas A&M, Missouri researchers

...to science of many graduate students, postdoctoral fellows and faculty with whom I have worked since 1968," Bazer said. "I am pleased to win this award and to share it with Dr. Roberts." Bazer received his bachelor's from Centenary College of Louisiana, his master's in 1963 from Louisiana State Univ...

Research shows less income, education not always top factors in child obesity

...ssor and professor, respectively, of nutrition and fellows at the Carolina Population Center. The research team set out to investigate why obesity is higher in minority groups. They analyzed nationally representative data collected from 13,113 U.S. adolescents enrolled in the UNC-based National Longitudin...

International experts to present at Plant Genetics 2003

...ndaresan. Graduate students and young postdoctoral fellows are welcome, he adds. "We're offering discounted registration rates and accommodations for students, because we consider this a critical opportunity to expand professional expertise and perspective." A general schedule of events follows. Complete...

Outstanding cancer researchers supported by the American Association for Cancer Research

...s, scientists who range in level from postdoctoral fellows to professors, were selected through a rigorous and highly competitive process. AACR-National Foundation for Cancer Research Professorship in Basic Cancer Research Manuel Perucho, Ph.D., Director, Oncogene and Suppressor Gene Program, The Burnham ...

Small talk--The gabfest of microbial communication

...tlefish: Vibrio harveyi and Vibrio fischeri. These fellows emit light in response to increases in cell population density they release and detect hormone-like molecules called autoinducers that accumulate in the surrounding aquatic environment as the bacterial cell density increases. Working with Vibrio ha...

Molecular defect may lead to osteoporosis

...l as Stephen Waldman and Danmei Liu, post-doctoral fellows in the Grynpas lab. The research received funding from the Institute of Musculoskeletal Health and Arthritis, the Canadian Institutes of Health Research and the Stem Cell Network of Canada....

'Frontiers In Bioinformatics' symposium to be held by UB Center of Excellence in Bioinformatics

... 16 is $125 for graduate students and postdoctoral fellows and $250 for professionals. For those who registe...16, the cost is $140 for students and postdoctoral fellows and $275 for professionals. The cost of attending one day of the symposium is $125 for those who re...

Johns Hopkins receives $24 million from Donald W. Reynolds Foundation to study sudden cardiac death

...ed to support cardiovascular research training for fellows and junior faculty. "Sudden cardiac death is ripe for a biological revolution," says Eduardo Marbn, M.D., Ph.D., director of the new Reynolds Center and professor of medicine. "If we can understand why specific patients have arrhythmias, we can tar...

UC Riverside's department of biology receives $953,000 GAANN grant

...grees. But more important, we hope that our GAANN fellows will have a broader and more in-depth understanding of biology."...

Researchers discover important genetic flaw in family affected by schizophrenia

...ty of Alberta graduate student, now a postdoctoral fellows at The Hospital for Sick Children, Toronto); Dr. Walter Muir (psychiatrist, Royal Edinburgh Hospital); Professor Malcolm Ferguson-Smith (Centre for Veterinary Science, Cambridge); and Dr. Cox (Medical Genetics, University of Alberta). Funding for the...

Yeast, wormwood & bacterial genes combine in microbial factory to make antimalarial drug

...ly Keasling's UC Berkeley coauthors: post-doctoral fellows Vincent J. J. Martin and Jack D. Newman and graduate students Douglas J. Pitera and Sydnor T. Withers. Other laboratories have tried to engineer the common intestinal bacteria, E. coli, to make isoprenoid precursors that could be used to produce drug...

Protein critical for development in fruit flies found to aid healing of cuts and wounds in mammals

...Cindy Gustafson-Brown and Guochun Li, postdoctoral fellows in Johnson's lab, produced a strain of mice that lacked the c-Jun protein in skin cells. Surprisingly, these mice were born with open eyes. Mice, like kittens and puppies, are usually born with closed eyes. Eyelid closure occurs in the later stages ...

New grants enable biomedical research centers to share science with their communities

...ants to involve graduate students and postdoctoral fellows in the outreach programs, in an effort to foster a commitment to public science education among the next generation of research scientists. "These grants enable HHMI to encourage our colleagues at biomedical research centers to share the content and...

Study reveals genetic activity of key step in malaria parasite's cycle

...Bozdech, PhD, and Manuel Llinas, PhD, postdoctoral fellows in the DeRisi lab, the researchers sought to identify the genes involved in carrying out the third, and harmful stage of the parasite's life cycle -- after it has passed from an infected mosquito to the liver of an infected person when it invades an...

The cogs that move the science policy wheel

...science policy and the science that will shape it, fellows past and present will gather at an event whose speakers include experts in science policy as it influences the areas of health, global security, climate, and the basic sciences. The Science and Technology Fellowship Program now has 1565 alumni--acco...

AGI Foundation endows congressional geoscience fellowship honoring William L. Fisher

...eing sought. The endowment will sponsor one to two fellows annually. Geoscience congressional fellows are in high demand on Capitol Hill because of their broad scientific training and the relevance of g...

Scientists determine identity, cell locale and quantity of nearly all proteins in an organism

...Won-Ki Huh, PhD and James Falvo, PhD, postdoctoral fellows in O'Shea's lab. Co-authors are Luke C. Gerke, BS, research associate; Adam S. Carroll, PhD, research specialist; and Russell W. Howson, graduate student. Lead author on the Nature letter in the same issue, "Global Analysis of Protein Expression i...

New genomic data helps resolve biology's tree of life

...p in Carroll's lab, which was led by post-doctoral fellows Antonis Rokas, Barry L. Williams and Nicole King, were able to assess the reliability of trees constructed using more than 100 genes. The result was a single tree with no doubt. "We were shocked. We didn't expect such an unprecedented level of resolu...

1 2 3 4 5 6 7

(Date:11/23/2014)... BambooFlooringChina.com , the world’s leader in bamboo flooring, ... flooring collection. Now, the business is announcing big discounts ... promotion is valid until Dec. 20, 2014. , The new ... dust-free surface, which makes it very easy to maintain. As ... wants to make its website the best shopping platform for ...
(Date:11/22/2014)... (PRWEB) November 23, 2014 Cancer researchers ... a connection between intercellular communication tunnels and the growth ... the full story on the Surviving Mesothelioma website. ... and the University of Minnesota have just released their ... information and materials between cells. They found that ...
(Date:11/22/2014)... Recently, Locks-Magnetic.com , one of the successful electrical ... locks for glass doors online. In addition, the company ... products. Customers can get more information on its website. ... excellent performance. Customers who want to buy this new ... They also can enjoy the one-stop shopping experience. ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 “Due to ... said an inventor, from Gurnee, Ill. “While using the ice ... be and I thought there needed to be a safer ... invented the SPIKE BLOCK. , The SPIKE BLOCK offers added ... so, it would help to reduce injuries and damage associated ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 "My ... the pain caused by the machine," said an inventor ... she had to go back a second time because ... invention idea." , She developed the patent-pending MAMO EASY ... breast cancer. The design saves the patient from the ...
Breaking Medicine News(10 mins):Health News:Click Strand Woven Bamboo Flooring From Famous Bamboo Flooring Company BambooFlooringChina.com 2Health News:Study Links Cellular ‘Tunnels’ to Mesothelioma Proliferation, According to Surviving Mesothelioma 2Health News:Discounted Mag Locks for Glass Doors Revealed by Locks-Magnetic.com 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford