Tag: "finds" at biology news

Stream size major factor in nitrogen reaching the Gulf of Mexico

... Ohio Valley states. But this new USGS study also finds that within these regions there are large differen...s of different sizes in the watershed. The study finds that the rates of nitrogen reaching the Gulf from upstream areas near large rivers in such states as...

NY pilot study pushes Human Genome Project toward cures for disease

... -- most notably, specially designed software that finds all the protein -- coding regions in a genome and also allows researchers to use structural and biochemical information to understand protein function. The scientists say that choosing medically relevant protein targets will provide benefits whether ...

Immune system chemical may predict worsening of coronary heart disease in women

...ning symptoms of coronary artery disease in women, finds a study in Heart. Researchers studied over 100 women with angina. Around two thirds of them had chronic stable angina, defined by characteristic pain on exertion or after exercise, and the remainder had unstable angina-the same symptoms, but occurrin...

Genes or environment: what shapes the sensory homunculus?

...n of receptors they carry. In the end, each neuron finds its proper spot in a spatial pattern that reflects the outside world. The molecular mechanism by which this occurs is poorly understood. Yet researchers do know that the ephrins act by repulsionthat is, neurons studded with many EphA4 receptors avoi...

UC Berkeley biologist disputes current dogma that genetic mutation is the cause of cancer

...l cells turns them into cancer cells," he said. He finds particular fault with a report last year in the journal Nature by Robert Weinberg and others of MIT's Whitehead Institute, in which the authors claimed to have accomplished just that. They took normal human cells and inserted two cancer-causing genes...

ASTA opposes EU proposal to label genetically modified seed

...n 900 seed-related companies in the United States, finds this proposal scientifically indefensible," says Executive Vice President Dean Urmston. "ASTA concurs with the U.S. House Committee on Science's April 13 report that says 'the United States should not accept any international agreements that violate ...

Measles infection and and two or more younger siblings seem to protect against asthma

... younger siblings seems to protect against asthma, finds a study in Thorax. Researchers from the University of Aberdeen investigated the association between the development of wheezing and atopy (allergic response) in adulthood among over 300 people, who, as children had been part of a health survey in 19...

Calcium is not as readily absorbed from soy milk as from cow's milk

...lcium in soy milk when compared to cow's milk, and finds soy milk less calcium-rich at current levels of fortification. 16 healthy men received 300 mg loads of labeled calcium in either soy or cow's milk during a light breakfast. Calcium absorption was evaluated from the concentration of calcium in serum 5...

Cocaine use while pregnant may cause ADHD

...versity and the University of Kentucky. The study finds that rat fetuses exposed to cocaine levels comparable to daily recreational use in humans show lasting dysfunction specifically in the area of attention. Researcher Barbara J. Strupp, associate professor of psychology and of nutritional sciences at ...

Genetic method has promise for assessing environmental cleanup

...the petroleum-based contaminants. After the primer finds and attaches to a matching piece of DNA, thousands of copies are produced through a well-known method known as polymerase chain reaction, which enables scientists to make billions of copies of a single strand of DNA. "Our detection technique requires...

Compound that switches off appetite in mice discovered by Hopkins scientists

Team finds a key pathway to appetite regulation June 23, 2000 -- Johns Hopkins scientists have produced a compound capable of rapidly turning off appetite in mice and causing weight loss similar in many ways to that achieved by fasting. When injected, the su...

Intriguing archaeological sites, isolated lake targets of Kuril Expedition

...lier Aleutian-Kuril connection. For example recent finds in the central Aleutians include prehistoric artifacts belonging to the Ainu culture of northern Japan or the Kuril Islands. These connections may have existed far into the past. People would have traveled by boat along the coast and we are looking...

Cadmium makes brittle bones in Rocky Mt. birds

...Colorado Rockies for more than a century. Cadmium finds its way into the environment when rainwater washes through the piles of ore tailings at abandoned mine sites. Most trees and other plants readily take up cadmium from the soil, but willows in particular act as biological pumps to biomagnify, or conc...

U-M scientist finds molecule plants use to control early cell development

U-M scientist finds protein signal and receptor molecule plants use to control early cell development. Similar structures common in animal cells. University of Michigan scientist Steven Clark has taken a major step toward understanding one of life's oldest mysteries--...

UC Davis research helps state air board set auto-emission rules

...echnology developed for the California market soon finds its way to cars sold in the rest of the world. Some of the influential studies published by the Institute of Transportation Studies are: -- Comparisons of auto technology life-cycle costs and energy use: This April 2000 report, produced for and funde...

Increased risk of wheeze and asthma in young children whose mothers smoke during the pregnancy

...nd asthma if their mothers smoke during pregnancy, finds research in the Archives of Disease in Childhood. This held true irrespective of the effects of exposure to environmental tobacco smoke. Over 8500 mothers were surveyed about their smoking habits during pregnancy and the respiratory health of their ...

Hopkins scientists shed light on how the brain 'thinks'

...internal model of reality in the brain. The report finds the specific shape and size of the primitives with which the brain builds internal models of physical dynamics. "By programming the robot, we can produce the dynamics of things that either exist naturally or don't make sense. We simulate the dynamics...

Boys still 'weaker' sex at birth despite improvements in treatment

... more susceptible to death and illness than girls, finds new research. The study, published in the Fetal and Neonatal Edition of the Archives of Disease in Childhood, shows that this is in spite of improvements in technology and drug treatments. The records of over 6,500 babies up to two weeks old, admit...

Life in extreme conditions

...er those kind of conditions, life goes dormant. It finds a way to preserve itself, " he says....

IIASA releases scientific study linking population growth to climate change

...e for Applied Systems Analysis (IIASA). The study finds that a more slowly growing population would produce less greenhouse gas emissions and would be more resilient to climate stresses on agriculture, human health, and migration. Although climate change policy makers have prioritized policies in energy e...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade