Tag: "fine" at biology news

EMBO Gold Medal 2004 goes to Spanish scientist

...ing just what can and is being achieved. Mara is a fine example of this. Her contribution to cancer research is unquestionable and her unstinting dedication makes her the ideal role model for other young researchers." Mara Blasco Background and research Born in Alicante, Spain, Mara Blasco is current...

Peering inside the body, with a new spinliterally

...pectral lines so much that information about those fine details is lost. Wind's slow-spin technique, which can generate detailed spectra from these boundary regions, takes advantage of a quirk in NMR. NMR generates a spectral signature of compounds in a sample based on the frequencies of the sample's atom...

Berkeley Lab soil scientist Margaret Torn receives Presidential Early Career Award

...sequestration in soils by studying the lifetime of fine roots, plant matter decomposition rates, and the p...ate-change simulations have achieved unprecedented fine resolution. Torn's previous research has taken her around the world, from Hawaiian rainfore...

Natural mineral locks up carbon dioxide

... "With our method, we do not need to crush it that fine and we do not need high temperatures. In fact, the reaction gives off heat. Our method is much less energy expensive." The researchers, who also include John M. Andresen, director of the Consortium for Premium Carbon Products from Coal (CPCPC), the...

NJIT chemist speaks Aug. 25 about compound derived from pine tree

... the synthetic processes in the pharmaceutical and fine chemical industry," said Malhotra. "These changes could make the current processes environmentally friendlier, more effective and less expensive." Malhotra and Ying Xiao, a doctoral student at NJIT helping him, developed a Diels-Alder reaction wit...

Two warbler species find the West isn't big enough for both of them

...ngton Cascades south of Mount Rainier. They used a fine net to capture individual Townsend's, hermit and hybrid warblers. All the captures came between 7 a.m. and 1 p.m. to minimize the effect on their measurements of hormone level fluctuations throughout the day. They lured the birds with taped warbler s...

Carnegie Mellon scientists reveal ways of studying, resolving PCB contamination in US rivers

... deploying everything from DNA fingerprinting to a fine mesh of carbon particles to augment the traditional sand caps that trap dangerous PCBs in sediments. Organized by Carnegie Mellon faculty, the American Chemical Society (ACS) symposium, "PCBs in Freshwater and Marine Sediments: Transport, Transfor...

Other highlights in the August 18 JNCI

...tified among specific subsets of families. Further fine mapping studies will be needed to identify any prostate cancer susceptibility genes in these regions, the authors say. Contacts: Wake Forest University: Karen Richardson ( krchrdsn@wfubmc.edu ) or Shannon Koontz ( shkoontz@wfubmc.edu ), 336-716-458...

Increasing international insect threat to stored food

...than worthless," Mr Rees says. "It may result in a fine from the environmental health department, negative publicity and lost consumer trust in a brand, and legal action." Mr Rees says that the introduction of an insect to poor farming areas of Africa is responsible for destroying stored grains and...

Oldest evidence for processing of wild cereals: starch grains from barley, wheat, on grinding stone

...arch grain analysis is painstaking work. First, a fine needle is used to dislodge minute particles from the face of a grinding stone. Then, the entire stone is placed in a sonicator, a water bath in which sound waves vibrate the artifact until smaller particles float free. Each microscopic starch grain...

New world record magnet for chemical and biomedical research

...eved with a set of superconducting shim coils that fine tune the magnetic field. Fabrication of the NbTi and shim coils occurred in cooperation with an industrial partner, Intermagnetics General Corporation. The achievement of producing a uniform 21.1 Tesla field in a warm bore of 105 mm is attributed to ...

Gene profiles could improve acute leukemia diagnosis and lead to better treatments

... different mechanisms. "Our ability to make such fine distinctions among the various subtypes of AML based on gene expression signatures is much like developing a dictionary," Downing said. "In this case, one gene expression signature defines a person as having a specific subtype of AML, while a person ...

Structure solved at Scripps shows how one human protein reduces potency of chemotherapy

..., by Research Associate Douglas Daniels, Ph.D. The fine details of this x-ray structure may help scientists find ways to fight certain cancers, such as brain tumors, which express high levels of AGT making them resistant to chemotherapy. "This structure provides a solid foundation for the development of ...

Microscopy scans show how brain cells process energy

...have converted from glucose." If that seems like a fine point, it is one that escaped scientists who developed PET and fMRI (functional magnetic resonance imaging) scanning technologies, as well as the medical personnel who use those diagnostic tools everyday without knowing exactly what the images repres...

A fly's taste experience is much like our own

...and deciding whether or not to eat it, without any fine taste distinctions, she said. This also is true of...ic taste notes of food. Odor receptors provide the fine discrimination of smells that allows us to distinguish foods and enjoy eating. "The simplicity of th...

Scientists learn how adjuvant makes vaccines effective

...ed forms of an infectious organism, generally work fine by themselves. But vaccines containing dead organisms (inactivated vaccines) or pieces of the infectious organisms or their toxins (acellular or recombinant vaccines) generally need adjuvants to boost their effectiveness. Aluminum salts, known as alu...

Tiny tango: Device sorts microscopic particles with speed and precision

...rapidly sorts microscopic particles into extremely fine gradations of sizes, opening a range of potential uses. The researchers have used the device to sort particles ranging in size from bacterial cells to large segments of DNA and reported their results in the May 14 issue of Science. The tec...

Continents played key role in collapse and regeneration of Earth's early greenhouse, geologists say

...ctures. This caused the methane to aerosolize into fine particles, creating a haze akin to that which today is present in the atmosphere of Saturn's moon Titan. This ''Titan Effect'' occurred on Earth 2.7 to 2.8 billion years ago. The Titan Effect removed methane from the atmosphere and the haz...

Biologists discover nerve activity, not just genetics controls kinds of neurotransmitters produced

...specifying everything, activity can play a role by fine tuning what neurotransmitters are expressed when the nerve cell finds its target." It is not yet clear how activity affects neurotransmitters in the adult nervous system, but Spitzer thinks there is a good chance activity will play a similar role the...

EMBL Director-General receives high German honour: the Bundesverdienstkreuz 1. Klasse

...state deeply committed to the European ideal, is a fine host for the Laboratory, supporting consistently the entire EMBL system. This support is all the more important now, when EMBL must invest in a timely manner in order to address immense new challenges: to elucidate complex biological systems and to o...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade