Tag: "former" at biology news

Scientists Locate A Genetic 'On/Off Switch' In Diphtheria; Find May Yield Antibiotics That Won't Boost Bacterial Resistance

...ger a major concern in the developedworld. But the former Soviet Union has experienced a sharp recurrence of thedisease during the 1990s, and public health officials are watching with alarm asthe outbreak trudges westward toward Europe. Ringe was joined in the work by Andre White and Xiaochun Ding at Brand...

Common Blood Pressure Drug May Promote Healthy Cells

...al Research and was co-authored by Yanzhang Wei, a former senior scientistin the Edison Biotechnology Institute; Matthew Huentelman and Craig Peters, 1998graduates in chemistry from Ohio University; and Alexander Boldyrev, formervisiting professor of chemistry from Moscow State University. Johnson is aprofe...

Constructing "Designer" Plant Enzymes

...tion's Departmentof Plant Biology, Pierre Broun, a former postdoctoral fellow at thedepartment, and John Sahanklin and Ed White of the Brookhaven NationalLaboratory report in the November 13 issue of Science on theirexperimental successes with directed interconversions of enymes thatmodify plant fatty acids...

Molecular Basis Of Leading Genetic Cause Of Infant Death Discovered

... Institute of Neurological Disease andStroke and a former Penn neurologist. "Now scientists will be able to work backfrom the biochemistry of the disease to eventually design new therapies." The findings demonstrate that the SMN protein plays a crucial role inthe genesis of mRNA from a precursor cal...

Biochemical Markers Could Help Identify Battered Children

...ge to neurons in injured brains. RandallAlexander, former vice-chair of the US Advisory Board on Child Abuse and Neglectand a paediatrician at the Morehouse School of Medicine in Atlanta, says thatthis is further evidence that victims of shaken baby syndrome can suffer morewidespread damage than those who r...

Fall Meeting: Updated Press Conference Schedule

...415-750-7145. Speaker: Dr. Cynthia Robbins-Roth, a former biotechnology research scientist who changed careers to become a biotech industry consultant and editor-in-chief of BioVenture View, a biotechnology industry newsletter, and Biopeople Magazine. She'll talk about her career change, how she covers the ...

Researchers Announce Breakthrough In Transgenic Animal Technology

...calproduction. Work performed in the laboratory of former University of Wisconsin-Madison dairyscience professor Robert Bremel, and by Gala Design LLC, a Sauk City, Wis.company, has resulted in breakthrough increases in the efficiency of theproduction of transgenic livestock. Dairy livestock are seen as key...

Major New Study Shows HIV-1 Antibodies Found In Urine

...portant public healthissue," said Dr. Roy Stevens, former director of the New York StateDepartment of Health Laboratories for Retrovirology/Immunology andchairman of the Clinical Immunology Division of the American Societyfor Microbiology from 1997 to 1998. "I support the concept ofcombination testing using...

Method May Be Key In Combating Diarrhea In Animals And Children

...guesTheresa B. Kuhlenschmidt, Howard B.Gelberg and former doctoral student Mark D. Rolsma, now a professor at AuburnUniversity. Speaking at the Second International Rushmore Conference on Mechanisms in thePathogenesis of Enteric Diseases, Sept.30-Oct. 3, in Rapid City, SD, Theresa Kuhlenschmidt reported pre...

Staring And Squirming Help Babies Explore

...estudents help collect and analyze the data. One former undergraduate student, James Reilly, human ecology '96, now aFulbright scholar studying clinical psychology at the University of Virgina,worked with Robertson for his senior honors thesis. An article reporting hiswork, with Reilly as the first autho...

Native Gray Ants Play Positive Role In Valley Peach Orchards

... enemies. But the article's co-authors, Daane and former UCBerkeley graduate student Jeffrey Dlott, found that it is the most importantpredator of peach twig borer larvae in peaches and nectarines. Peach twig borer, in its damaging larval stage, is a tiny worm thatfeeds on peach, nectarine, almond,...

Researchers Discover Why Some Athletes' Performances Fail To Improve On A Live-High, Train-Low Regimen

... incollaboration with Dr. James Stray-Gundersen, a former assistant professor ofsurgery at UT Southwestern who now works with Norway's Olympic ski team. The new study was published in the October issue of Journal of AppliedPhysiology. Levine's team, including Stray-Gundersen and UT Southwesternpostdoctoral ...

AAAS Report Attributes Majority Of Killings In Guatemala To State

... Guatemalan peace accords -- the governmentand the former guerrillas -- and the United Nations. The commission expects topublish the report so that the information is available to the Guatemalan publicand the international community. AAAS also helped the commission by designingthe information management s...

Researchers Find Genetic Connection To Cigarette Smoking

...romexamining 1,107 nonsmokers, current smokers and former smokers that theSLC6A3-9 gene was associated with ...king scores were found to besignificantly lower in former smokers than in current smokers. Those withlow levels of novelty seeking have an easier time giving ...

A Real Smart Asp: Snakes Show Surprising Ability To Learn

...yberg were joined in the research by AnitaStone, a former research assistant; Terrence Harris, now aphysician at Washington University; Guillermo Aranguren, now agraduate student at the University of Texas at Tyler; andElizabeth Bostock, a physician at the University of Rochester.The research was sponsored ...

Scientists Study Protein's Role In Tumor Development In Fish

...laborators at Cornell University.Lorie LaPierre, a former doctoral student at Cornell who now is a postdoctoralresearcher in biomedical sciences at Ohio University, was studying walleyeretroviruses when she discovered that these viruses contained the cyclin gene. Holzschu and LaPierre began working...

Mechanism For Fungal Adherence Found, Possible Key To Disease

... Several years ago, S.D. Bradway, a former assistant professor of periodontology at Ohio State and co-authoron this paper, showed that Candida albicans could formstable attachments. However, that work did not identify what ...

Seattle Researchers Zero In On Location Of Gene For Inherited Prostate Cancer; Gene Also Linked To Brain Cancer

... for the Cure of Cancer ofthe Prostate, founded by former Wall Street financier Michael Milken.Dr. Leroy Hood, professor and chair of the UW Department of MolecularBiotechnology, persuaded CaP CURE to donate funds to establish the Seattle-basedProstate Cancer Genetics Consortium at the UW and the Hutchinson...

UB Researchers Identify Specific Oral Bacteria Most Likely To Increase Risk Of Heart Disease

... oral diagnostic sciences; James Katancik, D.D.S., former UBgraduate student, and Sebastian Ciancio, D.D.S., professor and chair of the UBDepartment of Periodontology....

Harbor Branch Scientists Discover Bioluminescent Octopus

...thesucker/light organs. This work, carried out by former Smithsonian postdoctoralfellow Elizabeth J. Balser (now at Illinois Wesleyan University) with theassistance of HBOI summer intern Erin Fisher (now a graduate student at ScrippsInstitution of Oceanography), revealed that although these organs still ha...

1 2 3 4 5 6 7 8 9 10

(Date:8/27/2015)... ... 27, 2015 , ... Healthpointe is proud to welcome Dr. Ted Priebe, O.M.D., ... Licensed to practice Chinese Needle Therapy since 1983, Dr. Priebe specializes in the study ... also practices in Healthpointe’s La Mirada clinic and Garden Grove clinic. , ...
(Date:8/27/2015)... ... , ... More destinations and stores are becoming pet-friendly, making the family companion ... some tips to help your whole family travel safely and comfortably. , According to ... year. Amica is sharing the following tips from the American Society for the Prevention ...
(Date:8/27/2015)... , ... August 27, 2015 , ... Banc Intranets ... Clear System. The agreement will enable both Johnson City, Tenn.-based firms to work synergistically ... is a cloud-based safety product that caters to organizations in the financial, commercial and ...
(Date:8/27/2015)... , ... August 27, 2015 , ... ... high-performance blending all in one machine with the Nutri Ninja® Auto-iQ Pro Complete ... next-generation Auto-iQ™ Smooth Boost™ Technology that takes drink customization to a whole new ...
(Date:8/27/2015)... FL (PRWEB) , ... August 27, 2015 , ... Florida Hospital North Pinellas, located at ... Harbor in the Fall of 2016. The new facility will be located at US Highway ... , The property closed on August 18, and work on the project is slated to ...
Breaking Medicine News(10 mins):Health News:Qualified Medical Examiner and Acupuncturist Joins Healthpointe in Los Angeles 2Health News:Qualified Medical Examiner and Acupuncturist Joins Healthpointe in Los Angeles 3Health News:Amica Unleashes 5 Tips for Safe Traveling with Pets 2Health News:Banc Intranets Forms Strategic Marketing Partnership with All Clear System 2Health News:Banc Intranets Forms Strategic Marketing Partnership with All Clear System 3Health News:Banc Intranets Forms Strategic Marketing Partnership with All Clear System 4Health News:SharkNinja's Nutri Ninja® Auto-iQ™ Pro Complete Delivers Power And Versatility In A Compact Design 2Health News:SharkNinja's Nutri Ninja® Auto-iQ™ Pro Complete Delivers Power And Versatility In A Compact Design 3Health News:SharkNinja's Nutri Ninja® Auto-iQ™ Pro Complete Delivers Power And Versatility In A Compact Design 4Health News:Florida Hospital North Pinellas is Opening a New Free-Standing Emergency Room in Palm Harbor 2Health News:Florida Hospital North Pinellas is Opening a New Free-Standing Emergency Room in Palm Harbor 3
Other Tags
eadsannuallydeathsmultidisciplinarythicknessmischiefpoetprokaryoticsponsoredwebsinusendoscopicfragmentimpulsivityspatmattress