Tag: "fragment" at biology news

Technique Gives Researchers New Look At Genetic Activity In Living Cells

...s. Belmont created a roughly 10,000-base pair DNA fragment containing 256copies of the lac-operator sequence ... the lac-repressor protein,the location of the DNA fragment containing the lac-operator repeats isrevealed. The fragment is put into chromosomes by genetic en...

TSRI Scientists Discover Naturally-Occurring Mechanism Involved In Regulation Of Angiogenesis; New Anti-Cancer Therapeutic Agents Are Suggested

... but have developeda recombinant form of a protein fragment that blocks angiogenesis and tumorgrowth in an in ... angiogenesis can benaturally cleaved to produce a fragment that inhibits this process. Wedetermined that this enzyme fragment likely plays a role in normal blo...

Nitrate Reductase: A Magical Enzyme?

...em to determine the3-dimensional structure of this fragment of nitrate reductase, which houses theflavin in the complete enzyme. Now they can "see" it through the use of acomputerized model. "We're studying the structure of the enzyme with the goal ofunderstanding how it catalyzes the nitrate reductio...

The Bug Stops Here

...at oneend to a solid support. The remainder of the fragment floats freely, able tobind unknown bacterial DNA from a clinical sample applied to the support. If thebacterial DNA is a perfect match with the probe, they will bind together andactivate a fluorescent reaction. Fluorescence forms a black patch on une...

New Tests Demonstrate MuchLarger, More Specific Immune Responses To Viruses

...DA) has led scientists to believethat only a small fragment (1 percent to 5 percent) of activated CD8+ T cellsare responding to specific viral antigens, and that most of the T-cell responseis a general, non-specific one. Rafi Ahmed, Ph.D., Georgia Research Alliance Eminent Scholar in theEmory Depart...

A Synthetic Peptide Destroys Brain Plaque Implicated in Alzheimer's Disease

...hool of Medicine researchershave created a protein fragment that blocks the formation of a substanceimplicated in causing Alzheimer's disease, a finding that may lay the foundationfor a novel therapy for the mind robbing disease. Alzheimer's disease is characterized by the destruction of nerve cells,esp...

Fragmentation Of Tropical Forests Can Create "Genetic Bottleneck," According To New University Of Georgia Study

...r of seedlings and saplings in a onehectare forest fragment on their 38.5- hectare research area. (A hectare i...ercent came from onlytwo trees. Adults left in the fragment produced less than 5 percent of theseedlings in their own patches. The importance of the discovery l...

New Alzheimer's-Associated Mutation May Provide Key To Disease Process

...udies have shown that A2Mtightly binds the protein fragment A-beta, the major component of the amyloidplaques found in the brains of Alzheimer's patients. Those studies showed thatA2M facilitates the break-down and removal of A-beta from brain cells -- one ofthe processes that, when it goes wrong, are believ...

Australian Scientists In World-First Cell Discovery

...tor's structure, large quantities of the receptor fragment were produced in animal cells and purified to a very high level. The next step was to grow crystals from this material, much like salt crystals growing in a saline solution. The big difference is that the team's target crystal has over 7,000 atom...

Dismantling Dangerous Genetic Codes With A Faster, More Flexible RNA Mimic

...yme mimics is the incorporation of a smallchemical fragment near the catalyst that replaces an actual DNA base pair. Bashkin says the replacement gives the ribozyme mimics their flexibility andalso makes preparation easier, speeding up the testing of the molecules."They're much easier to prepare because they'...

Ancient "Jumping DNA" May Have Evolved into Key Component of Human Immune System

...processing" cells oncethose cells have displayed a fragment of the foreign molecule-those pieces arecalled antigens-on the processing cell's surface. So-called T-cell receptors onthe surface of the T lymphocyte bind strongly to the antigen. Although they perform different functions, both B and T lymphocytes u...

Penicillin Gets A "Checkmate" Against Antibiotic-Resistant Bacteria

...llin structurethat works by incorporating a unique fragment to the penicillin molecule, whichis fatal to bacteria and specifically activated only when a bacterium attemptsto cleave the drug's molecular structure. Any bacterium that does not producecleaving enzymes would still be killed off by the normal acti...

Fewer Songbirds May Be Result Of Forest Fragmentation Across The American South, New Study Suggests

...d was asignificant increase in predation as forest fragment size decreased. They alsofound that small fragment... small species remained constant nomatter what the fragment size. Thus it appears that songbirds nesting in small forest fragments bear anincreased burd...

Discovery Of New Fossils In Gobi Desert Of Mongolia Provides Important Insight Into Early Mammal Evolution

... One of the specimens was preserved with a crushed fragment of a mammal skull ( since broken remains are very rare at Uhkaa Tolgod, it is possible that the mammal was the Deltatheridium's last meal. The location of Deltatheridium in Central Asia suggests that modern marsupials, which today are most diverse in...

First Complete Fossil Of Fierce Prehistoric Predator Found In South Africa

...the museum's curator ofgeology, found a small bone fragment jutting from sedimentary layer associatedwith the latest part of the Permian period. The layer marks the geologicalboundary between the Permian and Triassic periods. Smith and Peter Ward, a UWgeological sciences professor, excavated the site and foun...

Cellular Target Of Leprosy, Deadly Viruses Found

...hat it attached to DGonly in the presence of a key fragment of laminin. This finding suggested thatthe bacteri...chers also found that a combined bacterium-laminin fragment wouldbind to both rat and human Schwann cells, which normally surround and protectnerve cells. When ...

Master Switch May Help Cancer Cells Hide From Immune System

...is attached to it. The MHC-I molecule carries that fragment to the cell surface where the fragment sticks out on display. In this way, a bit of every protein produced in cellsends up displayed on th...

Serendipity: Cell Structure Study Uncovers Taxol's Secrets

...l viruses, eachgenetically engineered to exhibit a fragment of a different cellular protein. They then screened the library to find which bacterial viruses bind to Taxol. In addition to microtubules, they found that Taxol also binds to aprotein called Bcl-2, a molecule first discovered in human B-cel...

Fool An Egg Into Thinking It's Fertilised, And It Will Repel All Comers

...ged peptide with mouse eggs. The tagged fragment bound only to a re-ceptor called alpha-6/beta-1integrin (Chemistry & Biology, vol 6, p 1). "The integrins are really anintriguing target," says Sampson. Some evidence from frog eggs hints that anintegrin receptor can activate the egg and prompt it to...

UCSF/Gladstone Finding May Explain HIV'S Ability To Infect Cells Lacking The Key Target Of HIV: The CD4 Receptor

...dies, we even showed that it required only a small fragment ofthe outside portion of CD4, known as the D1 domain. Apparently, CD4, or evenjust a portion of it, when juxtaposed with the co-receptor on a target cell, canreconstitute a full permissive system," he said. The researchers suspect that the extra-cel...

1 2 3 4 5 6

(Date:11/23/2014)... BambooFlooringChina.com , the world’s leader in bamboo flooring, ... flooring collection. Now, the business is announcing big discounts ... promotion is valid until Dec. 20, 2014. , The new ... dust-free surface, which makes it very easy to maintain. As ... wants to make its website the best shopping platform for ...
(Date:11/22/2014)... (PRWEB) November 23, 2014 Cancer researchers ... a connection between intercellular communication tunnels and the growth ... the full story on the Surviving Mesothelioma website. ... and the University of Minnesota have just released their ... information and materials between cells. They found that ...
(Date:11/22/2014)... Recently, Locks-Magnetic.com , one of the successful electrical ... locks for glass doors online. In addition, the company ... products. Customers can get more information on its website. ... excellent performance. Customers who want to buy this new ... They also can enjoy the one-stop shopping experience. ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 “Due to ... said an inventor, from Gurnee, Ill. “While using the ice ... be and I thought there needed to be a safer ... invented the SPIKE BLOCK. , The SPIKE BLOCK offers added ... so, it would help to reduce injuries and damage associated ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 "My ... the pain caused by the machine," said an inventor ... she had to go back a second time because ... invention idea." , She developed the patent-pending MAMO EASY ... breast cancer. The design saves the patient from the ...
Breaking Medicine News(10 mins):Health News:Click Strand Woven Bamboo Flooring From Famous Bamboo Flooring Company BambooFlooringChina.com 2Health News:Study Links Cellular ‘Tunnels’ to Mesothelioma Proliferation, According to Surviving Mesothelioma 2Health News:Discounted Mag Locks for Glass Doors Revealed by Locks-Magnetic.com 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford