Tag: "functional" at biology news

Oldest-known arm bone found in Pennsylvania

...use it represents a part of the anatomy where many functional changes were taking place. "It's a mosaic of primitive fish and derived amphibian," said Shubin, lead author of the paper. This integral piece of the evolutionary puzzle not only shares features with primitive fish fins, but also has characteristics ...

Fat hormone leptin alters brain architecture and activity, which in turn drives feeding behavior

...s suggest that these leptin-induced structural and functional changes are responsible for changes in the animal's behavior, too. Six hours after administering leptin to obese mice, changes could be seen in their synaptic connections. Forty-eight hours later, they were eating less and at 12 days the mice had lo...

Heinz Maier-Leibnitz prizes 2004

...ing research in the area of time-dependent density functional theory. Filipp Furche studied chemistry at the Universities of Freiburg and Karlsruhe and completed his doctorate in theoretical chemistry at the University of Karlsruhe under Professor Reinhard Ahlrichs in 2002. After a year of postdoctoral study un...

NJIT chemists pave way for cheap, usable field test for polluted, toxic, water, air, food

... Miniaturization using nanotechnology yields many functional and economical benefits because of the reduction of a necessary sample size, the decrease in reagent consumption and the lower costs of mass production. However, scientists cannot sacrifice results to create alternatives. "Yes, the idea behind ...

NIST-led research de-mystifies origins of 'junk' DNA

...own function) that it takes up more space than the functional parts. Much of this junk consists of "introns," which appear as interruptions plopped down in the middle of genes. Discovered in the 1970s, introns mystify scientists but are readily accounted for by cells: when the cellular machinery transcribes a g...

New tumor suppressor may play important role in deadly brain tumors

...ional Institutes of Health," says Garkavtsev. "Its functional role in the prevention of tumor progression had not been investigated. When we found that malignant gliomas have strikingly lower levels of ING4 and knowing that ING4 regulates angiogenesis, this sparked interest toward potential targets that were in...

Study offers new model for breast cancer

...mmary glands of mice. As a result, the mice formed functional breasts that are capable of producing human breast...orate human epithelial cells. The mice soon formed functional human mammary glands, and when these mice became pregnant, the engrafted cells produced human breast...

Researchers confirm novel form of the Rett syndrome protein

...s interesting and raises questions about potential functional differences between the two proteins," said Zoghbi. "Currently about 15 % of patients with a clinical diagnosis of RTT are testing negative for mutations in the MECP2 gene. This development may help to further identify mutations in exon 1. Incorporat...

Combination therapy drives cancer into remission

... frequently ineffective against tumors that lack a functional programmed cell death mechanism. Such tumors are said to be chemotherapy-resistant. The evasion of treatment-induced programmed cell death by chemotherapy-resistant tumors has been a major impediment to successful therapeutic outcomes for human cance...

Pittsburgh NMR Center for Biomedical Research at Carnegie Mellon

...ter dedicated to advancing molecular, cellular and functional imaging using small animals....

Alcohol consumption can damage hearing

... receptor and transmitter changes, may explain the functional changes and cognitive deficits that precede more severe structural neuronal changes." For this study, researchers recruited two groups of males from the University of Ulm: 19 head- and neck-tumour patients, representative of heavy drinkers according ...

Deficits associated with prenatal alcohol exposure can be seen as early as infancy

...red IQ scores and difficulties with learning basic functional and academic skills. The arousal difficulties may result in behavioral disturbances and meltdowns from being over-aroused and not being able to appropriately calm down when needed." These findings also help illuminate a somewhat controversial area...

MGH research team grows long-lasting blood vessels

...successfully induced the growth of new networks of functional blood vessels in mice. In the March 11 issue of Nature, the team from the Steele Laboratory in the MGH Department of Radiation Therapy describes how their technique led to the growth of long-lasting blood vessels without the need for genetic manipul...

McGill scientists publish detailed picture of how nutrients and other molecules get into cells

...ructions for making the proteins. Proteins do the functional work in the cell and are much more complex than DNA. The roughly 30,000 human genes lead to more than three hundred thousand different proteins. The ability to rapidly and globally detect proteins represents the next step in biology. Revolutions i...

Educational program increases some safety behaviors for older drivers

...r who wants to remain behind the wheel about their functional deficits that affect driving skills and to facilit...e an older adult has a chronic disease that causes functional impairments since it can have such negative consequences on older adults," said Dr. Owsley. "They ne...

UW study: Baby's face lights up emotional center of new mom's brain

...otos during a series of brain scans. The scans, or functional magnetic resonance images (fMRI), captured activity in the mothers' brains. While in the scanners, the mothers also rated their moods on a nine-point scale based on five feelings: happy, warm, loving, motherly and excited. The mothers, when seeing p...

New study seeks to establish mechanism between areas of the brain and continence

...e males), all without symptoms, were studied using functional magnetic resonance imaging (fMRI) to detect brain activity. Studies were done in two stages. In stage 1 (10 subjects, 5 male), anal sphincter pressure was monitored from a catheter-affixed bag. Subjects performed maximal and submaximal EAS contractio...

Marsupial among model organisms next in line for sequencing

...catalog of yeast genes and to predict a new set of functional elements thought to play a role in regulating genome activity. Experiments to validate the existence of these and other predicted elements, and study their function within the cell, are expected to enhance understanding of how the human genome works....

Secondary complications and restoration of function in SCI

...e development of enhanced neuroprostheses that use functional electrical stimulation to restore standing and wal...s in the muscles of able-bodied individuals during functional electrical stimulation. There is also much interest in using electrical stimulation for the rehabili...

Evolution caught in the act

...occur in many enzymes, but never before had such a functional iron-sulfur complex been introduced into a protein as a result of laboratory evolution. James Penner-Hahn, a professor of chemistry and chair of the Biophysics Research Division at U-M, showed exactly what kind of iron-sulfur cluster was involved. ...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan