Tag: "getting" at biology news

Alzheimer's disease is not accelerated aging

...t occur in older adults without dementia. "We're getting a better understanding of the complex constellation of factors that change [in the brain] with aging," said Howard Hughes Medical Institute researcher Randy L. Buckner of Washington University in St. Louis. "When you start to look across the litera...

University of Alberta researcher looks for clues to mysterious disease

...llar question--how does ATM work, and we're slowly getting closer to understanding it." ...

16th EORTC-NCI-AACR Symposium on Molecular Targets and Cancer Therapeutics

...second generation antisense cancer drug - phase II getting under way * Dr Grant McArthur: Award winning researcher reveals potential new role for Glivec in a soft tissue cancer Chairman: Professor Jaap Verweij (EORTC chairman of conference scientific committee) together with scientific committee co-chairmen...

Certain genes boost fish oils' protection against breast cancer

...s believe that women whose bodies do a poor job of getting rid of the fish oils' byproducts are the ones who benefit most from consuming the oils. That may help scientists better understand exactly how fish oils deter cancer. "In this study, we found that women with certain common DNA patterns experienced mo...

Genes expose secrets of sex on the side

...migrating more, but if just half as many males are getting their genes into the next generation on average as are females, then it implies more males are migrating to do that." The pattern the researchers see in our genes doesn't require mass migrations of people across continents. The s...

Students build submarine to track Octopuses

...move the dome. So we had all this moist, salty air getting into everything." Lesson learned. Students will repackage all the electronics inside the sub to protect it from salt air when Shadow inevitably has to be adjusted on-site. Repackaging the computer parts will be the latest in a long list of modificati...

IBD (Crohn's/ulcerative colitis) conference adds 18 speakers; APS meeting starts Thursday

...ity of the abstracts reflects the fact that IBD is getting the kind of research attention it deserves and needs. "Over the past 15 years, IBD has gone from a somewhat invisible, almost orphan disease to one where almost everyone you talk with knows someone" with either Crohn's Disease or ulcerative colitis, ...

Viral suspect for amphibian decline traced to human spread through bait

...d Collins. "Bait is one of the ways it is probably getting around. "We found evidence for this specific virus in salamanders in bait stores in Phoenix and also evidence of it in axolotls (salamanders that remain in the larval gilled form) in the Indiana University colony that are shipped all over the world...

Smac-ing back at cancer cells

...no acids of Smac was the way to go, but we weren't getting anywhere. But in one of the chemical reactions, we actually made a dimer linking the molecules in pairs. That dimer, Compound 3, turned out to be much more active." The scientists believe the twinned molecule is more active because the Smac protein ...

Fossils reveal direct link between global warming and genetic diversity in wildlife

...s than 1,000 years ago. That means gophers are not getting any fresh, new genes from somewhere outside because they're isolated." While previous studies have shown that interbreeding usually occurs among large populations of animals, "this study shows that gene flow is occurring when population sizes are low...

Genetic map of important tree genes outlined

...e able to breed more scientifically, and we're now getting closer to the day we can really do that."...

Identifying tick genes could halt disease, bioterrorism threat

...roteins that prevent the host immune response from getting rid of them." Currently very little is known about the tick genome, which is about two-thirds the size of the human genome, Hill said. Many animals and plants have similar genes with similar functions, but ticks have some unique genes different even ...

Optimizing protein's 'death domain' halts leukemia in laboratory study

...al Science. "We have demonstrated an approach for getting at potential new drugs by using natural sequences [of amino acids] that have known biological effects," says Stanley J. Korsmeyer, MD, of Dana-Farber, co-senior author of the paper. "In this case we took the critical killer domain out of a pro-death ...

Flame retardants found on supermarket shelves

...globe, but scientists are not certain how they are getting there. Our paper is the first U.S. market basket food survey for brominated flame retardants, says the studys lead author Arnold Schecter, M.D., M.P.H., an environmental health expert at the University of Texas School of Public Health in Dallas. ...

Molecular motor myosin VI moves 'hand over hand,' researchers say

...ion, the argument for a rival 'inchworm' motion is getting pretty weak," said Paul Selvin, a professor of physics at the University of Illinois at Urbana-Champaign and a co-author of a paper to appear in the Journal of Biological Chemistry. Myosin VI is a reverse-direction molecular motor that moves material...

Review article makes case for a new source of cells in the body

...NT cells then travel along nerve paths, eventually getting ahead of the nerves, and dispersing throughout the body. "They travel in association with the cranial nerves to target tissues, disperse into those tissues, then, at what is perhaps an endpoint for their stay during development, they differentiate in...

Unicellular organisms contribute more nitrogen to ocean that reported earlier

...arge, nutrient-poor expanses of the open ocean are getting a substantial nitrogen influx from an abundant group of unicellular organisms that "fix," or chemically alter, nitrogen into a form usable for biological productivity. First identified about five years ago, these organisms about 7 microns in diamet...

Bright idea could doom cancer and viruses, say Purdue scientists

..."Another issue is how to keep these compounds from getting scavenged up by the blood before they reach their targets, which tends to happen because of their adhesion to blood proteins," Morrison said. "But I believe the results are promising for the future of the fight against cancer and viruses, and I hope ...

Trojan Horses, xenon imaging and remote controlled genes

...one of the major obstacles to research is actually getting inside of cells and tissue to see what is going on as it happens. At the University of Pennsylvania, researchers are caging molecules xenon, gene-blocking strands of antisense DNA and even therapeutics to facilitate their entry into cells and enab...

Last of known genes identified in complex obesity syndrome

...aged to link BBS3 to a region of chromosome 3, but getting to the gene had proven challenging. Now, by taking advantage of their recent discovery that faulty cellular structures called cilia are behind the problems seen in BBS patients, the researchers were able to zero in on the disease-causing gene. Cilia...

1 2 3 4 5 6 7 8 9 10

(Date:11/23/2014)... BambooFlooringChina.com , the world’s leader in bamboo flooring, ... flooring collection. Now, the business is announcing big discounts ... promotion is valid until Dec. 20, 2014. , The new ... dust-free surface, which makes it very easy to maintain. As ... wants to make its website the best shopping platform for ...
(Date:11/22/2014)... (PRWEB) November 23, 2014 Cancer researchers ... a connection between intercellular communication tunnels and the growth ... the full story on the Surviving Mesothelioma website. ... and the University of Minnesota have just released their ... information and materials between cells. They found that ...
(Date:11/22/2014)... Recently, Locks-Magnetic.com , one of the successful electrical ... locks for glass doors online. In addition, the company ... products. Customers can get more information on its website. ... excellent performance. Customers who want to buy this new ... They also can enjoy the one-stop shopping experience. ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 “Due to ... said an inventor, from Gurnee, Ill. “While using the ice ... be and I thought there needed to be a safer ... invented the SPIKE BLOCK. , The SPIKE BLOCK offers added ... so, it would help to reduce injuries and damage associated ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 "My ... the pain caused by the machine," said an inventor ... she had to go back a second time because ... invention idea." , She developed the patent-pending MAMO EASY ... breast cancer. The design saves the patient from the ...
Breaking Medicine News(10 mins):Health News:Click Strand Woven Bamboo Flooring From Famous Bamboo Flooring Company BambooFlooringChina.com 2Health News:Study Links Cellular ‘Tunnels’ to Mesothelioma Proliferation, According to Surviving Mesothelioma 2Health News:Discounted Mag Locks for Glass Doors Revealed by Locks-Magnetic.com 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford