Tag: "global" at biology news

Carnivore species are predicted to be at increased extinction risk from human population growth

...here human populations are growing faster than the global average. Based on the researchers' projections, some species currently considered low conservation priorities--such as members of the weasel-like viverrid family--could soon become endangered. Altogether, these results indicate that as human populati...

$1.86 billion boost for UK science and innovation

...cience base to compete in the twenty-first century global economy. Today's framework represents a long term ... bolstering the UK's position as a growing hub for global knowledge-intensive businesses." The ten year investment framework for science and innovation can be...

When sun's too strong, plankton make clouds

...e the plankton-made clouds may have some affect on global temperatures. This is important in light of man-ma..."There is the potential that this cycle could slow global warming," said Siegel. "But right now we have no idea of the size of it or even what it means." In ...

Chipmunks descended from ancestors that survived last ice age, scientists say

...for some animals to survive. "Overall, in light of global climate change occurring today, our results indicate that predictions of movements and where organisms may or may not end up will not be as straightforward as the literature up to now has led one to believe," said co-author Ken N. Paige, head of the ...

Report outlines steps needed to lessen smallpox threat

...nal release of the virus would "probably provoke a global health crisis." The report states that "the lethality of the disease (up to 40 percent) and its ease of transmissibility place variola virus at the top of the [Centers for Disease Control and Prevention's] list of high threat (category A) agents." Gi...

Warren Pharmaceuticals publishes results of preclinical evaluation

...eck has partnered with Warren and has been granted global and exclusive rights to the therapeutic areas of the central and peripheral nervous systems. Warren has retained all rights for indications outside of Lundbeck's field, including the eye, cardiovasculature and diabetic complications. Accompanying the...

Key principles for the foundation of a European Research Council (ERC)

...RC is intended to help secure Europe's competitive global position in science and research. A future ERC mus...ch, that the European Research Area can survive in global competition only if efforts in this area are increased and do not remain purely a matter of national...

Asian bird flu became highly pathogenic through continued circulation and gene swapping

...rden by themselves. "If we consider H5N1 to be a global problem that could get much worse, perhaps the cos...e borne instead by the World Health Organization's global influenza program," Webster said. "The results of this study are a wake-up call for the world to pro...

UCSD undergraduates participate in collaborative studies abroad on cyberinfrastructure

...ntific endeavors, particularly in the context of a global workforce. The students all from UCSD's Jacobs School of Engineering are also expected to develop their research methods and skills, while achieving greater understanding of the cultural environments of their host countries. Each undergraduate has ...

Global competition closes Texas sawmills/paper mills

...ex, having largely to do with the economy becoming global and the cost of doing business in the United State...rvice, cites newsprint prices as an example of the global interdependency. In the early 2000s, Asian newsprint paper mills, using recycled paper, began comin...

New space-borne instrument to track greenhouse gases, ozone destroyers, and other pollutants

...should reveal where Earth will warm or cool as the global climate changes. Why does the tropopause exist and what is its role in conveying gases from the troposphere into the stratosphere, especially in the tropics? Convection was once thought to be the vehicle, but scientists now know warm, rising air no...

Wistar-discovered antibody will help diagnose appendicitis

...ging, a St. Louis-based unit of Tyco Healthcare, a global medical products company headquartered in Bermuda. "The success of NeutroSpec reflects the Philadelphia area's enormous strengths in biomedical research and development," says Russel E. Kaufman, M.D., president and CEO of The Wistar Institute. "Contr...

As humans alter land, infectious diseases follow

...am of experts warns that widespread changes in the global landscape are providing new opportunities for doze...gnificantly to the spread of Lyme disease. A more global example is the AIDS virus, which scientists think may have first infected "bush meat" hunters given ...

Design competition for new Antarctic Research Station

...he new station will allow long-running research on global change to continue at the site where the ozone hole was discovered. The enormous logistical challenges of building on a floating ice shelf that is accessible only during the Antarctic summer by ship, requires innovation and creativity in design, eng...

Deserts and rainforests are equally productive during drought

...s have strong implications for the future. Current global models do not take into account climate variation ...n drought, according to the RUEmax data, the older global models are likely to overestimate the capacity for plant production. We can't underestimate the valu...

Scientists call for better protection for coral reefs

... ISRS Briefing Paper 3 discusses the effects that global climatechanges like warmer temperatures, higher pr...he sustainable management ofreef fisheries and the global challenges these ecosystems face....

Hope Clinic of Emory Vaccine Center receives CDC contract

...ctive methods to prevent HIV and other diseases of global concern. The clinic has been conducting clinical trials of HIV vaccines for the past three years. The recent development of topical vaginal microbicide gels resulted from the increase in incidence rates of HIV and AIDS among women and the need for ...

Underground carbon dioxide storage reduces emissions

...dioxide underground may have huge implications for global warming and the oil industry, says a University of...rganic matter. CO 2 emissions have been linked to global warming, and there has been a worldwide effort to reduce those emissions and their effects on the pl...

'Plants for the future': A European vision for plant biotechnology towards 2025

...orth America, to contribute to meeting the growing global food demands," says Marc Zabeau, chair of EPSO. These immense challenges can be met by prioritizing basic and applied research goals that are tailored to the needs of European society and the agriculture and the food industries. The expertise and cap...

Tulane opens doors to discovery

...tson. On the third day, attendees will discuss the global epidemics of the future, including infectious diseases, biodefense and obesity. Speakers on Saturday include Jaime Sepulveda, director of the Mexican National Institutes of Health, infectious disease specialist John La Montagne and nutritionist Barr...

1 2 3 4 5 6 7 8 9 10

(Date:3/5/2015)... 2015 Taking center stage at ... Texas April 9-11th is IDRevolution hosted by IDLife ... nutrition. IDLife offers a variety of nutritional ... customized approach to vitamin supplementation is based upon ... free HIPAA compliant online assessment and ends with ...
(Date:3/5/2015)... 2015 Supply & Demand Chain Executive ... “Pros to Know” in the supply chain industry, and ... MEBC’s leadership team were included on this year’s list! ... this award due to their hard work, their commitment ... meeting and resolving client needs and challenges. ...
(Date:3/5/2015)... For PASCHA Chocolate, less is more. ... robust flavor of the cacao bean bursts through without ... free from peanuts, nuts, dairy, soy, eggs, fish, wheat, ... 8th at Expo West., ,    NEW PASCHA Make ... new ground with their New PASCHA Make Me Smile! ...
(Date:3/5/2015)... 2015 Dr. Jonathan Glashow a board ... has been named by Castle Connolly as ... Dr. Glashow has been selected by Castle Connolly Medical ... top specialty care doctors in the tri-state metropolitan New ... program, which carefully screens and selects doctors through a ...
(Date:3/5/2015)... Minneapolis, Minn. (PRWEB) March 05, 2015 ... authority, invites healthcare organizations to participate in its ... includes data from executive and director-level positions, and ... , Last year’s report featured data on ... 28 independent children’s healthcare organizations and 7 subsidiary ...
Breaking Medicine News(10 mins):Health News:IDLife Partners John C. Maxwell and Troy Aikman speaking at IDRevolution in Fort Worth, TX April 9th-11th, 2015 2Health News:MEBC Leaders Awarded Supply Demand Chain Executive Pros to Know Title For 2015 2Health News:PASCHA Allergen Free Organic Chocolate to Appear at Natural Products Expo West March 6-8, 2015 2Health News:Dr. Jonathan Glashow, NYC Orthopedic Surgeon, Named Top Doctor: New York Metro Area 2Health News:Participation Is Now Open For INTEGRATED Healthcare Strategies 2015 Children’s Hospitals Executive Compensation Survey 2
Other Tags
behaviorseducationalbakerfungidonekoreacomparingbogsdisablingminorgainingfaminevargervikpharmacologyhershjones