Tag: "high" at biology news

Maternal Lead Exposure Linked To High Numbers Of Cavities

Exposure to high amounts of lead is likely one cause of thehigh rat...irst to document the link betweenlead exposure and high cavity rates that a few smallepidemiological studies have suggested. The team is now searching ...

Researchers Discover First Animal Strain Of Hepatitis E Virus

... virus might explain the relatively high prevalence of hepatitis E antibodies in healthy individuals in the United States." If that were the case, says Dr. Meng, the strong immunologic cross-reactivity of the swi...

Pea Plant Stem Growth Gene Cloned

.... "Mendel's experiments are now included in every high school biology class," said Davies....

Discovery Of Genetic Pathways May Provide New Ways To Combat Candida Infections

...lar, poses a serious threat and is associated with high mortality rates in patients undergoing chemotherapy. Candida is also a major cause of infection in hospitalized patients, especially those in Intensive Care Units, patients after major injuries or surgery, patients with burns, and premature babies. ...

Basin Traps Air Pollution In Mexico City: International Study Has Implications For U.S. Cities

...lection sites. "Thecomplex movement of air in the high basin makes it difficult to predict wherethe pollu...ve the ground.Another tool, called SODAR, provided high resolution measurements of wind flowup to 500 meters above the city. Ground stations at each site m...

Lethal Parasite Prime Suspect In Fish Kills At Salton Sea

... She found 22 to be infested with moderate to high levels of a lethal parasite of warm-water mar...ed, parasite levels can build up to extremely high levels in fish. Healthy fish in aquaria can die after only 12 hours of exposure to Amyloodini...

Hunt For Early Heart Attack Genes Begins

...rdiovasculardisease, which includes heart attacks, high blood pressure and stroke, accordingto the AHA. Heart attacks, which claimed more than 487,000 lives in 1994, causeone in every 4.7 American deaths. People younger than 65 account for 45 percentof heart attacks. "We have good evidence that ...

Wonder Thread: UD Scientists Report First Protein With Collagen And Elastin-Like Domains

...he elastin-like regions of preCol-P also contained high levels of glycine and alanine--the amino acids most prevalent in two forms of protein in spider silk, Waite says. Although the structural similarity between preCol-P and spider silk still must be verified, Waite says the possibility should interest b...

OHSU Scientists Discover Mice Lacking Dopamine Receptor Are Supersensitive To Alcohol, Cocaine And Methamphetamine

... interest since itsdiscovery in1990 because of its high affinity for the antipsychotic drug clozapine, which isused to treat schizophrenia. Recently, several new D4-selective drugs that aresimilar to clozapine have been developed and are currently undergoing clinicaltrials for the treatment of schizophre...

CTC Visualizations Help Ecologists See The Forest And The Trees

.... The technicaland artistic challenge of producing high quality videos of the simulationswas the job of Ca...." Initially at least 200 frames were rendered at high resolution for eachsimulation. Final videos included up to 2000 frames per sequence and avideo seque...

Nutrients, Ground Water, And The Chesapeake Bay - A Link With Pfiesteria?

...ely fish health. Scientists suspect a link between high nutrient levels in water and the occurrence of alg..., but the amount can be as low as 27 percent or as high as 85 percent. The amount of ground water varies according to the type of rockand sediment beneath t...

Imaging Studies Illuminate Brain's Response To Cocaine

...easurablerush/high experience. But its continuing high level of activation into thecraving phase suggests that it also plays a role in incentive, the motivationleading to a change in behavior, which is key to the development of addiction."Alan Leshner, PhD, director of the National Institute on Drug Abus...

New Way To Drive Chemical Reactions: Collision Of Liquids At High Speed

...aid. The jets are made by pumping liquids at very high pressures through verysmall holes drilled in gemstones. "Only gems are hard enough to takethe pressure without cracking or eroding," Suslick said. Currently,liquid jets are used industrially for making emulsions (such as cosmeticlotions) and for cu...

Further Proof That An Altered Rb-2/p130 Gene Leads To Lung Cancer

...ell growth control. The p107 protein is found in high levels in breast and prostate tissue. The pRb-2 protein is present in high amounts in normal lung cells. Yet when Rb-2/p130 is altered and cannot produce pRb-2 , the cel...

Long-Term Vitamin C Use Cuts Cataract Risk In Older Women

...igible members of the NHS were ranked according to high or low vitamin C intake, using totalconsumption (d...essary to enrich the group with womeneither in the high or low consumption categories. But the examiner had no knowledge of thenutrient status of any of th...

Disease Takes Its Toll On Waterfowl Populations

... losses at one southern Saskatchewan lake to be as high as 300,000 to 500,000 birds. Also this year, at the Bear River Migratory Bird Refuge, along the shores of the Great Salt Lake, U.S. Fish and Wildlife Service biologists report waterfowl mortality from botulism has reached nearly 100,000 birds. Most...

Colorado State Anthropologist Finds Fossil Treasures In Africa

... in harnesses and other rock-climbing equipment as high as 15 feet above the cave floor, carrying drills andother excavation tools. The main chamber below the Drop Room, known as the atrium, consists of spectacular stalactite formations. The atrium's ceiling iscovered with a rock matrix containing the bo...

Limits Of Life On Earth: Are They The Key To Life On Other Planets?

...nd ice sheets, anoxic habitats, hypersaline lakes, high altitude or polar deserts, and human-engineered environments such as those created for industrial processes. Projects involve finding techniques for isolating and culturing microbes found in extreme environments, developing methods of studying these...

Synthetic Vitamin E And Natural Vitamin E Are Equally Powerful Antioxidents

... of natural or syntheticvitamin E in patients with high cholesterol. "Such a large dose may have inundated the physiological system, negatingany differences that might have been seen with lower doses," said Jialal, who isalso a professor of pathology and internal medicine. In a randomized,...

Insects Provide Clues About Bodies Underwater

...oroner, says the research will be useful,given the high number of water-related deaths in B.C. It's alsogroundbreaking. The first study of a body decomposing underwater took placein Tennessee only three years ago. No research has been done in Canada. Infact, Macdonell planned to remove her pigs months ago...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition