Tag: "hours" at biology news

University of Chicago researchers uncover first steps in cell-cell adhesion process

...ed puncta rows the "adhesion zipper." Several hours after the calcium concentration was raised, Vasioukhin observed that some of the puncta in the rows fused into one dot. "It is as if the puncta are the teeth of a zipper, and when an adherence junction starts to form, the zipper closes to form a si...

Non-toxic peptide blocks spread of prostate cancer in rats

... Rats in this group which first received PHSCN 24 hours after surgery developed 99 percent fewer visible lung metastases and 95 percent fewer microscopic lung micrometastases than rats treated with surgery alone. Livant admits that the exact mechanism of PHSCN's anti-cancer activity remains unknown, alth...

Scientists develop most efficient mouse cloning strategy to date, create transgenic clone

...ed strain developed to term. All 8 died within 24 hours after birth, demonstrating that genetic make up of donor cells may be a key to survival of clones. "Embryonic stem cells from outbred mice created clones with better efficiency than embryonic stem cells from inbred mice. Thus, the ability to gene...

INEEL microbiologist joins Japanese on expedition to tap marine-methane deposits

...chniques and the real work began -- sometimes four hours on, four hours off -- taking sample after sample, processing one meter at a time. Time passed more quickly then an...

UCSF researcher reports on protein therapy to reverse facial birth defects

...this treatment, Helms' group found that even a few hours of vitamin A blockage at the right stage of development led to severe holoprosencephaly. "We produced chick embryos that completely lacked a forebrain, and had no middle and upper face. Such conditions are lethal both in humans, and in these chick e...

Brain neurochemicals, not gender, tell a female to act like a female

...man fish of the type I variety, which vocalize for hours under rocks to attract females. When type I males' courtship songs are successful, females briefly visit the nests to deposit eggs, then leave the type I males to fertilize the eggs and raise the young. Sometimes, however, the type I males' songs ha...

Isle Royale wolves doing well

...rcass. "When we returned to the site nearly three hours after the attack, we noticed a lone male from the...ent to check on other wolves. When we returned two hours later to check on the situation, both animals were gone. "We saw them again five days later about a...

NC State scientists confirm second toxic pfiesteria species

...e between the two species' DNA. Glasgow spent 200 hours over two years mapping the surface of hundreds of Pfiesteria zoospores using a scanning electron microscope. In so doing, he found that many specimens had a different "fingerprint" - they had a four-sided structural plate on the outside of the cells ...

Common pesticide product reduces testosterone levels

...ne production in developing Leydig cells after ten hours of treatment, and in adult Leydig cells after 18 h...testosterone inhibition, the researchers waited 18 hours in each case to see whether testosterone production in these cells recovered to the levels observed ...

Athletes take note: Not all energy bars built the same

... Volunteers had to fast for at least 12 hours before taking part in each of ... levels at 15-minute intervals for up to two hours after each experimental meal. The volunteers had to wait at least 24 hours ...

How a hormonal henchman triggers death

...d really cares that it's only got a couple of more hours to live. "We do know that the ecdysone pulse induces many genes in the gland, and it's possible that the burst of diap2 activity right before its death preserves an important final function it's trying to hold onto." One pleasant surprise, said ...

Aptosyn™ (exisulind) and other SAANDs target early event in cancer; AACR presentations detail novel apoptotic pathway

...ed the expression of PDE2 by 250% as early as four hours after exposure to the drug and reduced the expression of PDE5 by 50% after 48 hours, with no effect on the other eight families of PDE enzymes. "It appears from these studies that the cancer cell may try to circumvent the effect of the drug by i...

Soy protects heart without disrupting hormones: Study

... each diet, the researchers collected urine for 24 hours from all the participants at the end of each month and tested it on human breast cancer cells. Since estrogen stimulates breast cancer cells to produce a special protein, the researchers measured the amount of this protein produced by each urine samp...

White House honors Hutchinson Center Scientist with Presidential Early Career Award

...hrill of watching a ball of cells transform within hours into a distinct, structurally sophisticated organism. "Development in general, but zebrafish development in particular, is beautiful to watch," she says. Because zebrafish embryos are transparent -- almost as clear as glass -- and grow outside their ...

Hair loss with chemotherapy could be on the way out

...ach chemotherapy treatment and wash it out several hours later. "The work is very well done," says William Hait, director of the Cancer Institute of New Jersey. He expects the treatment to be simpler and more effective than the "ice helmets" often used during chemotherapy. "It's just part of a whole effo...

Mashed potatoes prepared with heart healthy oil beats rice for appetite control

...apeseed). Specter says that during the first four hours after the lunch, the men reported being hungrier i...saturated oil, they were less hungry four to eight hours after eating than when fed the same starches prepared with polyunsaturated oil. The effect was most...

New protein separation technology

...has many advantages over gels. "The process takes hours instead of days. It can handle large quantities of protein and detect trace amounts of protein," Lubman says. "It is easily interfaced for mass spectrometry detection, data are automatically digitized online and the entire process has the potential...

University of Pittsburgh researchers develop computer system to predict impending arrhythmia and sudden death

...t a cardiac arrhythmia or sudden death up to eight hours prior to the onset of symptoms. The system is bas...e onset of the arrhythmia as long as four to eight hours before the event. This research is part of a collaborative effort between the University of Pittsbur...

Dietary changes don't prevent recurrent polyps, eight-center study shows

...ritionist for counseling and attended more than 50 hours of individual and group dietary counseling sessions. The control group got general dietary guidelines from the National Dairy Council -- but no additional nutritional or behavioral help. The trial lasted for four years. Doctors repeated colonoscopi...

Study: breath test effective in showing patients who should get less cancer drug

...he reason you need to take it again in four to six hours is that your body has chewed it up and gotten rid ...ples from 21 cancer patients several times over 24 hours to determine how fast their livers cleared the drug docetaxel and compared those results with result...

1 2 3 4 5 6 7 8 9 10

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue