Tag: "immunology" at biology news

A paradox helps explain how aspirin works

...laro, M.D., Ph.D., assistant professor of clinical immunology at Hopkins, reporting in the March issue of Blood. Aspirin, the world's most used non-steroidal anti-inflammatory drug, provides the mainstay of therapy for inflammatory musculoskeletal disorders and has been shown to be effective in the mana...

Epstein-Barr virus linked to invasive breast cancer and lymphoma

...tson is an assistant professor of microbiology and immunology in the U-M Medical School and a researcher in the U-M's Comprehensive Cancer Center. "The Epstein-Barr virus is associated with many human cancers -- including Burkitt's lymphoma, nasopharyngeal carcinoma, Hodgkin's disease and invasive breast canc...

UNC-CH study indicates special vaccines could prevent insulin-dependent diabetes

...and Tisch, assistant professor of microbiology and immunology at the UNC-CH School of Medicine. "In the past, our group and others could manipulate the damaging auto-immune response in various animal models for type I diabetes but not in ways that would be readily feasible clinically." A report on the resea...

Veterinary researchers seek secret to reversing birth defects

...henomenon. They knew that fundamental reproductive immunology suggests maternal immune cells dont routinely traffic across the placenta. This is in part because the fetus is genetically different from the mother and will be recognized by her immune cells as foreign, resulting in what is known as a negative "gra...

Study sheds new light on Lyme disease transmission

...ilva, PhD, assistant professor of microbiology and immunology at the University of North Carolina at Chapel Hill...D, UNC postdoctoral researcher in microbiology and immunology and Joseph Piesman, PhD, division of vector-borne diseases at the Centers for Disease Control and Pr...

UC Davis study shows spirulina boosts immune system

...te professor of rheumatology, allergy and clinical immunology at UC Davis. "Through research, we are learning exactly how these foods improve immune system function and how they are a beneficial addition to our diet."...

Dendreon identifies novel approach to improve immunization efficiency

...ad author of the publication and vice president of immunology at Dendreon Corporation. "This is a novel approach with important implications for the immunotherapy of cancer." The methodology described in the report is applicable to the development of a variety of vaccines and highlights a method for generating...

Penn State researchers unravel key facts about how a virus exits a host cell

...eaking." Wills, professor of microbiology and immunology at Penn State College of Medicine, says a virus must mature and "pinch off" a cell membrane before it becomes infectious. This pinching off process is called budding. In previous research, the Penn State researchers identified the Gag (groups specifi...

Contract bridge enhances the immune system, according to a preliminary study by researchers at UC Berkeley

...s before and after the sets, and delivered them to immunology research associates Peter Schow and Stan Grell to measure the numbers of immune cells. Only the levels of CD-4 positive T cells changed in the 12 subjects. In two of the groups, levels increased significantly. In the third group, T cell levels incre...

Searching for the secrets of drug-free transplants

...because of its ongoing contributions in transplant immunology and its body of research that has resulted in about 40 liver transplant recipients in a physician-controlled trial being able to be completely weaned off anti-rejection drugs. The patients have been drug-free for a mean of 6.6 years. Typically, a l...

Five Rutgers professors named fellows of national science association

...s cited by AAAS "for contributions to the field of immunology and the developing field of neuroimmunology." Ganea, who lives in Allentown, Pa., joined Rutgers in 1988 and teaches upper-level undergraduate and graduate courses on immunology, and organizes the department's annual seminar series. Her major area ...

AIDS vaccine study harnesses 'killer' immune cells to control virus, prevent disease in animals

...mmune response, they borrowed a concept from tumor immunology studies and added a fusion protein that included a lymphocyte growth factor. The fusion protein elicited a more sustained immune response when they attached to the DNA vaccine a second plasmid encoding the protein instead of directly injecting the pr...

MS clinical trials confirm approach, demonstrate need to carefully refine targeted peptide therapy

...kly for up to 9 months while using clinical tests, immunology work-ups, and MRI scans to carefully monitor the effects of the therapy in patients. Two out of eight treated patients showed an increase in inflammatory brain lesions that was linked to the APL therapy by sophisticated studies of their immune cells...

Little-known substance regulates inflammatory response

...eril Ma, M.D., assistant professor of medicine and immunology at the University of Chicago, who uses transgenic mice to study the basic biology of inflammatory bowel disease. "We created mice that lacked the A20 gene, hoping to identify its function in intestinal lymphocytes," he said. Instead they discovere...

Massive new research effort will map inner workings of cells - San Francisco VA Medical Center chosen to host core laboratory

...en a very large single lab," said Seaman, chief of immunology at the San Francisco VA Medical Center and UCSF professor of medicine and microbiology. And unlike most research projects, scientists in the Alliance will publish their data on the Internet immediately after it has been analyzed, instead of waiting t...

New HIV model

... Ph.D., an assistant professor of microbiology and immunology in the U-M Medical School. "A very small percentage of cells dies from apoptosis on a daily basis, but over a seven-year period, it adds up to almost 100 percent." Results from the U-M model are consistent with what happens in people, according t...

Hopkins research may bring 'sigh' of relief to asthmatics

...s Togias, M.D., an associate professor of clinical immunology and principal investigator of the study, which appears in the August issue of the Journal of Applied Physiology. For years, scientists have used the drug methacholine to study asthma because it narrows airways and causes wheezing in asthmatics, but n...

UNC opens first clinical trial of vaccine treatment for advanced breast cancer

...sociate professor of medicine and microbiology and immunology at UNC-CH School of Medicine. "This is the first use of a vaccine directed against a modification of a specific part of the HER-2/neu protein found on breast cancer cells," he added. People have tried using engineered proteins in the treatment of m...

Modified HIV may be effective for delivering and regulating gene therapy

...ri, Ph.D., assistant professor of microbiology and immunology at UNC-CH School of Medicine. Kafri conducted the study while he was a postdoctoral scientist with Inder M. Verma, Ph.D. at the Salk Institute in La Jolla, California. In earlier experiments, Kafri and others had studied the potential feasibility of ...

Virus linked to Kaposi's sarcoma sabotages immune system with a new and unusual strategy

...edical Institute and professor of microbiology and immunology at UCSF. Ganem is senior author on a study describing the new research. In the virus-immune system arms race, each new deployment by one side is met with a riposte from the other, Ganem says. "And there's every reason to believe this race isn't ove...

1 2 3 4 5 6 7 8 9 10

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid