Tag: "infants" at biology news

Maternal DHA levels plays important role in infant development

...HA improves vision and some cognitive functions in infants and toddlers, although the evidence is mixed. In t...e measured DHA levels in mothers' blood when their infants were born. We then followed those infants for the first two years of their life, evaluating them on...

Institute for OneWorld Health receives Gates Foundation grant

...prevention and treatment of malaria, including for infants and children in the developing world. Globally, more than 300 million cases of malaria occur annually and one million people, mostly children, die of the disease. Resistance to existing drugs and lack of both affordable and adequate treatments c...

University of Chicago scientists pinpoint cellular cause of SIDS

...ortality in the United States. Approximately 3,000 infants die each year from the disorder, according to the Centers for Disease Control and Prevention. In the July 8, 2004, issue of the journal Neuron, the researchers describe the specific group of neurons that are responsible for gasping and what happens ...

Early dexamethasone exposure has long-term neurodevelopment, neuroendocrine effects

...f exposure to dexamethasone in critically ill ELBW infants spans an extensive period of perinatal viability, ...y and central nervous system function in premature infants have been limited. Past research into premature infants who received prolonged dexamethasone thera...

RSV can increase the risk of asthma, UT Southwestern researchers find

...e leading cause of viral respiratory infections in infants and children worldwide. "We have suspected a conne...r. Ramilo. About 10 percent of high-risk and young infants with RSV infections will develop severe bronchitis and require hospitalization. Earlier studies hav...

Monkey business: Studies show tiny callimicos have unusual characteristics

...cooperative infant care, sharing food and carrying infants on their back. Porter said fruit and, to a lesser degree, grasshoppers are callimicos' primary foods. However, in the Amazonian dry season when fruit is scarce, the monkeys switch to fungi that live on bamboo and rotting wood as a dietary staple. T...

Existing drug may prevent brain injury and seizures in newborns

...s Jensen, have found that the neurons of premature infants and other newborns have more glutamate receptors t...re clinically limited paradigm. Because premature infants are typically maintained in a continuously monitored, intensive care setting, it's feasible to comme...

New laboratory model can be used to test new treatments for pediatric eye cancer

... Retinoblastoma is the third most common cancer in infants after leukemia and neuroblastoma (nerve cancer). Retinoblastoma that has spread outside the eye is among the deadliest childhood cancers, with an average survival rate of less than 10 percent. Until now, researchers had no reliable animal model in wh...

Cells may shoot messenger to halt protein production

...nemia, which causes the loss of red blood cells in infants and children, and may contribute to changes in gene activation in cancer. The mechanism involves a recently discovered enzyme that destroys the ribbon-like molecules of messenger RNA (mRNA). Messenger RNA is a copy of gene, and it contains informatio...

Researchers find no link between alcohol consumption during pregnancy and asthma during childhood

...his colleagues gathered data on 10,440 single-born infants who were born at 36 weeks of gestation or later to mothers attending midwife centers between April 1984 and April 1987 in Denmark. Mothers completed a questionnaire regarding lifestyle and socio-economic factors, including alcohol consumption. The ...

'Cardiofunk' mutation: Probable source of congenital heart defects

...pe with the consequences of heart malformations in infants after birth, the researchers said. The full effect of the mutation on valve formation could not be discovered in a mouse or human because the developing embryo would quickly die if the valve failed to allow blood out of the heart, starving the growin...

New research outlines public health consequences

...ease in the incidence of small for gestational age infants as compared to pregnant women from a demographically similar population not known to have been in Manhattan at the time. "We had hypothesized that long-term exposure to air pollutants generated by the collapse of the towers might be associated wit...

Breastfeeding decreases infant mortality

...hat breastfeeding can reduce the risk of death for infants in their first year of life. Looking at infants between 28 days and one year of age, researchers concluded that promoting breastfeeding can potentia...

University of Pittsburgh receives NIH funding to develop heart assist device for infants

...pport currently available in the United States for infants and children up to age 2 is ECMO, or extracorporea... a high death rate. Less than half of children and infants survive the therapy. Larger children sometimes have the option of being supported by ventricular ass...

Polio victory remembered

... drawing attention to the importance of immunizing infants against 12 vaccine-preventable diseases by the age of two with the theme, "Love Them. Protect Them. Immunize Them.""Immunization has been cited as one of the ten greatest public health achievements of the 20th century. Millions of children have been...

Researchers discover cold virus can 'hit and hide'

...ldren during their first year of life and for some infants RSV leads to bronchiolitis, one of the major cause...isation in the Western world. Around 40 percent of infants who experience bronchiolitis as a result of RSV infection are subsequently affected by recurring whe...

First flavors form a lasting impression

... these early influences systematically by studying infants who are breastfeeding, as well as babies whose par...earchers compared flavor preferences of bottle-fed infants raised on two different types of commercially-available infant formula. One was a standard milk-bas...

JCI table of contents, 2 April 2004

...hropathy, the most common form of renal failure in infants and children. Obstructive nephropathy is often caused by structural blockage, due to the presence of stones. In many cases, however, the underlying cause seems to be a functional blockage, for which the molecular basis remains unknown. Feng Chen ...

Chatty finches

... they communicate with in a manner akin to the way infants learn to speak, which is in contrast to mice and non-human primates who don't learn their vocalizations. Constance Scharff, head of the Neurobiology group at the Max Planck Institute for Molecular Genetics, therefore asked whether the songbird FoxP2 ...

Study shows benefits to newborns from federal ban on insecticides

...g almost 200 grams (almost half a pound) less than infants with no detectable pesticide levels. The researche...ergens. The present study included a sample of 314 infants of African American and Dominican women in Washington Heights, Central Harlem and the South Bronx....

1 2 3 4 5 6 7 8 9 10

(Date:6/29/2015)... (PRWEB) , ... June 29, 2015 , ... ... recognized by the independent auditor of customer service for the 40-center nursing home ... than 1,100 skilled nursing centers in the United States in one or more ...
(Date:6/29/2015)... ... June 29, 2015 , ... ... filed against C.R. Bard, Inc. and Ethicon, Inc. continue to move forward ... next Case Management Conference is to be convened on Thursday, July 23rd at ...
(Date:6/29/2015)... ... ... USA Today reported on June 18th the overdose death rate has ... rest of the nation’s growing overdose death rates in 26 other states the U.S. ... stop the increasing overdose trend from continuing: , , Encourage and ...
(Date:6/29/2015)... ... June 29, 2015 , ... The world’s fastest and ... Aviation Museum to the Science Museum of Virginia. This iconic, supersonic stealth plane will ... , “Suspending a supersonic jet from the ceiling of a historic train station is ...
(Date:6/29/2015)... ... ... The Food Safety and Technology Research Centre under the ... (PolyU) has developed a new method for rapid authentication of edible oils and ... in food safety, and becomes particularly important with the emergence and widespread use ...
Breaking Medicine News(10 mins):Health News:National HealthCare Centers Receive 'Customer Experience Awards' 2Health News:National HealthCare Centers Receive 'Customer Experience Awards' 3Health News:National HealthCare Centers Receive 'Customer Experience Awards' 4Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 2Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 3Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 4Health News:Overdose Death Rates Decreased in Florida as of 2015 2Health News:Overdose Death Rates Decreased in Florida as of 2015 3Health News:SR-71 Prepares for Flight to Science Museum of Virginia 2Health News:PolyU develops a new method for rapid authentication of edible oils and screening of gutter oils 2
Other Tags
europainappropriatecharacterizationingeniumbecamealaskainertreactattemptinterviewingmotivationalexaminingelephantiasisclarifyingvolmanifesto