Tag: "intervention" at biology news

Leader in cancer treatment and prevention research honored

...esearch to uncover biochemical and molecular-based intervention strategies to halt and/or reverse the human carcinogenesis process," Dr. Alberts said. Summing up his current work, Dr. Alberts added, "We are just beginning mechanistic studies of novel agents which hit and disable specific molecular targets in the ...

Researchers identify protein promoting vascular tumor growth

...pies and, even sooner, an experimental nutritional intervention for vascular malformations. "Previous work in our lab has shown that a certain form of berry extract significantly regulates MCP-1 function," said Sen, who served as a mentor to Gordillo on this research. The trick will be regulatin...

A novel, safer strategy for regulating gene expression

...rning genes on and off as needed that involves an intervention as simple as giving a drug. Potentially, with this technique, a gene could even be activated by natural conditions in the body for example, in a diabetic patient, a rise in glucose concentration would automatically turn on the gene responsible for...

Reducing allergens in the home helps inner-city children with asthma

... Journal of Medicine, showed that an environmental intervention designed to reduce allergen levels in the home ind...ers were educated about how to perform the various intervention strategies themselves. Asthma, a chronic lung disease, affects about 20 million Americans. Inne...

Study reveals first genetic step necessary for prostate cancer growth

... wasn't likely to progress or that he needed early intervention that could save his life." The study, funded by the National Cancer Institute and the Prostate Cancer Foundation, was led by Lisette Maddison, Ph.D., a former graduate student of Greenberg's who is now a postdoctoral fellow at Oregon Health and Scien...

Protemix corporation announces discovery of way to repair hearts damaged by diabetes

...ing from diabetes and may lead to a more effective intervention in a major cause of death worldwide. A study 1 p...f the disease. There is a distinct possibility for intervention and treatment. This work needs now to be transferred into larger scale clinical trials. It has been ...

Managing occupational exposures to potential bioterrorist agents

...l occupational exposures at USAMRIID allowed early intervention with post-exposure antibiotics. No individuals who were evaluated to determine their need for antibiotics subsequently became ill. Based on the success of this practice, the Rusnak team developed a flow chart for evaluation of potential exposures and...

Brain's reward circuitry revealed in procrastinating primates

...eptors by measuring receptor binding following the intervention in two other monkeys' brains. "This new technique permits researchers to, in effect, measure the effects of a long-term, yet reversible, lesion of a single molecular mechanism," said Richmond. "This could lead to important discoveries that impact p...

Early clinical treatment can halt progression of Alzheimer's disease, UCI researchers find

...ological lesions of the disease, provided that the intervention is administered early in the course of the disease."...

'Smart gene therapy' protects against damage from heart attack

DURHAM, N.C. — Early intervention with a novel kind of "smart gene therapy" might effectively prevent the organ damage commonly suffered by heart attack victims, suggests a new animal study by researchers at Brigham and Women's Hospital in Boston and Duke University Medical Center. T...

Brookhaven lab biophysicist F. William Studier wins R&D 100 award

...ically to producing the target protein without any intervention by the experimenter. The new method will be useful for biomedical research or for industrial production of proteins to use as enzymes, diagnostics, vaccines, therapeutics and targets for developing pharmaceuticals. "The new autoinduction system is v...

UNC researchers awarded $8.65 million from National Institute on Aging

... the new knowledge gained will provide a basis for intervention strategies, which will be the next phase of this project." ...

Virtual counselor supplements traditional genetic counseling

...has the potential to stand alone as an educational intervention for low-risk women, but should be used in combination with one-on-one genetic counseling for women at high risk," said Michael J. Green, M.D., M.S., associate professor of humanities and medicine, Penn State College of Medicine. "The computer program...

A pathway to blocking autoimmunity

...tion and gene expression and is an entry point for intervention into autoimmunity by modulating CD1d expression, and NKT cell activation. "We think PPAR-gamma is capable of orchestrating a coordinated response whether endogenous ligands arrive from outside of the cell or are generated inside the cell," Nagy said....

Inflammation's trigger finger

...cancer. However, it is a difficult target for drug intervention because it is a vital component of most cells in the body; curbing its activity could kill all cells, including healthy ones. Verma and his group hope that by pinpointing other molecules that help NF-kB do its job, they may find new ways of stopping ...

'Crack babies' do better when placed with non-family caregivers

...e, support could be provided either through direct intervention with children, by supporting women in their recovery from substance abuse, and/or in helping mothers improve their parenting skills. Finally, our study suggests that "kin" caregivers of cocaine-exposed infants and toddlers may also need support and ...

Anxiety during pregnancy affects child behavior

...ver, provide an impetus for developing prevention, intervention and support programs for highly anxious pregnant women. These programs could include stress reduction instructions as well as treatments to reduce anxiety and neuroendocrine reactions to stress throughout the pregnancy, or even before conception. T...

Genetic mutation found that is major contributor to type 1 diabetes

...er predict who will get the disease and design new intervention strategies for those who do," said Dr. Jin-Xiong She, director of the MCG Center for Biotechnology and Genomic Medicine and a co-senior author on the study. "The mutation we have found is going to increase the responsive capacity of the immune system...

$5 million grant funds partnership, studies of minority-based issues in reproductive health

... a combination of two drug therapies and lifestyle intervention in women with polycystic ovary syndrome, a condition that causes irregular periods, inability to get pregnant and excessive facial and body hair. All three of these studies offer participants compensation for their participation. For more informatio...

Brain development and puberty may be key factors in learning disorders

...is is correct, it suggests a strong need for early intervention and a potential for improving the abilities of individuals with learning difficulties," said Wright. "With early identification of children with language-related learning disabilities, we may be able to remediate many of these problems by 'training' ...

1 2 3 4 5 6 7 8 9 10

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting