Tag: "investment" at biology news

Half-million dollar landmark achieved for the Methuselah Mouse Prize

... as quickly as possible. The future return on your investment is a longer, healthier, and ultimately better quality of life for yourself and your loved ones."...

Far more men than women favor routine paternity testing at birth

...e the child's genetic heritage or to gain parental investment from more than one male. Either way, it would normally be advantageous for the woman to keep the child's paternity a secret so that her husband would continue to care for the child as if he were the father. "There's this fascinating aspect that w...

Anthrax enzyme images reveal secrets of antibiotic resistance, suggest new drug design

...thor. "The pharmaceutical industry is reducing its investment in developing new antibiotics," Babaoglu said. "So it's important that academic institutions fill in the research gap to ensure we will have effective treatments for these infections in the years ahead."...

The book opens on the first tree genome

... necessary for accurate gene prediction. The total investment in the Swedish Populus program exceeds $10 million, $3 million of which is directly connected to the genome sequencing effort. Stanford University served as an integral part of JGI's sequence finishing and quality control operation. Ghent University...

Yale digital diagnostic technology is basis of new company, HistoRx Inc.

...tivity out of pathology diagnosis." Rana Gupta, an investment partner at Navigator Technology Ventures, said HistoRx's technology is not only novel and state-of-the-art, but it has the potential to significantly reduce the risk of clinical trial failure and move new drug candidates through the development proce...

The future of HIV therapeutics is brightening, according to Gladstone Institutes Director

...y," he explains. "This will require commitment and investment by the world community not only for the key drugs but also for the infrastructure and training required to ensure their effective use."...

Washington University in St. Louis plays key role in sequencing moss genome

...atrano. A number of national agencies made a prior investment in this organism that was instrumental in the success of the present JGI proposal, Quatrano noted. Beyond programs in the United States and the United Kingdom, the Physcobase program at the National Institute of Basic Biology (NIBB) in Japan and Res...

Columbia, Stony Brook, Guidant to develop biological pacemaker based on gene & cell therapies

...ls can help pace the heart. This five-year, phased investment will build on recent basic research conducted at t...ptions for people with heart disease. Terms of the investment are not being disclosed. Research at the universities suggests the possibility of developing a bi...

Nevada researcher re-ignites mammal reproduction debate

...sirable, having female offspring would be a better investment for mammal parents. "Male zebras can father more than a hundred offspring in a lifetime, whereas female zebras are constrained to minimal reproductive rates--about one a year," Cameron said. "Sons, therefore, offer higher breeding rates to zebra par...

New OHSU lab will speed drug discovery process

...oop said. "Small molecule analysis is an important investment to have on the hill. We've already had more than 50 investigators query about our services." The BSR will complement the work of the Proteomics Shared Resource that was launched earlier this year, and it uses mass spectral methods to identify and cha...

Ottawa's leadership in biomedical and health research has paid off

...s into diseases and new economic growth. Continued investment in biomedical science is crucial, he said. The new government has an opportunity to put forward an ambitious vision of the future that will benefit all Canadians....

New framework for biodiversity conservation

...r job of predicting land availability and creating investment opportunities than do conservationists," says Andelman. "It goes beyond conservation science to human psychology figuring out how we can get the pieces of land with the biggest conservation impact. It requires data conservationists have not historic...

Leading scientists design new framework for biodiversity conservation

...r job of predicting land availability and creating investment opportunities than do conservationists," says Ande... bet-hedging strategies methods routinely used by investment bankers and stock brokers into conservation plans. "It goes beyond conservation science to human ps...

$1.86 billion boost for UK science and innovation

... today as the UK Government published its ten year investment framework for science and innovation. The framewor...obal knowledge-intensive businesses." The ten year investment framework for science and innovation can be found at HM Treasury website. 1 British pound = $1.8637 ...

$1.6 million grant to Williams College

...liams College. The award is part of a $606 million investment in undergraduate science by HHMI. To help colleges meet the challenges of keeping up with emerging scientific fields, inspiring excellence in teaching, assisting interdisciplinary collaborations, and encouraging minority students to pursue careers i...

New $9 million NSF grant to fund creation of center at LSU

... "This center draws upon the significant amount of investment by the state and the university in micro- and nano-fabrication," said Soper. "It brings a diverse group of people under one roof to draw major national funding and respect."...

New version of premier global climate model released

... director of NSF's climate dynamics program. "The investment by the NSF, the Department of Energy and the scientific community is yielding new insight into the complexities of the Earth system and the likely responses of our planet to natural and anthropogenic influences." CCSM3 shows global tempera...

Study helps explain island populations' susceptibility to exotic diseases

...nvestigates the relationship between immunological investment (how developed is the body's immune system), native parasite abundance, and island size. The findings were published online June 8 in the Proceedings of the Royal Society of London. The paper helps scientists understand how island populations respond...

Scientists raise awareness of need for sound science in age of fad diets

...tion united by a commitment to advance and sustain investment in our nation's fundamental and applied agricultural research. For more information refer to our website at www.cofarm.org...

First ever standards linking climate change, biodiversity and poverty seek global peer review

... used for projects with private investment, public investment or a combination. "The CCBA offers Intel the opportunity to efficiently address several important global issues in one organization," said Terry McManus, Intel Fellow, Intel Corporation. "We hope that these standards will influence the array of polic...

1 2 3 4 5 6 7 8 9

(Date:8/29/2014)... August 29, 2014 According to these recent ... of Herpes and HPV cases in the last few years. ... the nature of these infections and the symptoms that make ... an STD. While some people aren't aware of the exact ... infections.” , The steady increase in the number of cases ...
(Date:8/29/2014)... August 29, 2014 How can ... proposition and provide top notch services. Dr. Michael ... practice by partnering with a double board certified ... launching two new websites! , Dr. Fiorillo’s services ... face surgical procedures. Some of these are breast ...
(Date:8/29/2014)... Today, Fecbek, a well-known female boots manufacturer and retailer, has ... The new items are offered in many styles, including sexy ... these products are nice-looking and elegant with the latest styles. ... , A boot is a type of footwear and a ... and the ankle and extend up the leg, sometimes as ...
(Date:8/29/2014)... Today, Progene reaches another milestone as the only testosterone ... healthcare network , but also with enrolled providers nationwide who ... few weeks ago. Today, we’re now recommended by healthcare ... , The network adds an unprecedented level of service to ... and after they make a purchase -- with the best ...
(Date:8/29/2014)... York, ON (PRWEB) August 29, 2014 Most ... professional needs to find a break in their day to ... always easy for business professionals to find a few hours ... announcement by North York Dental so important. It is now ... care that they need. , What is happening? , North ...
Breaking Medicine News(10 mins):Health News:It was reported that the Number on PositiveSingles.dating increased about 20% in 2014 2Health News:Michael Fiorillo’s Advanced Plastic Surgery Center Expansion – New Vein Specialist and Websites Launch 2Health News:Michael Fiorillo’s Advanced Plastic Surgery Center Expansion – New Vein Specialist and Websites Launch 3Health News:Nice Boots for Sale at Fecbek.com 2Health News:Progene Is Doctor Recommended Nationwide 2Health News:Progene Is Doctor Recommended Nationwide 3Health News:North York Dental Provides Dental Services to Busy Professionals 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes