Tag: "leading" at biology news

Long-term effects of carbon monoxide poisoning are an autoimmune reaction

...arbon monoxide (CO) poisoning. CO poisoning is the leading cause of injury and death by poisoning worldwide, with about 40,000 people treated in the U.S. annually. Brain damage occurs days to weeks later in half of the patients with a serious case of CO poisoning. The physiological causes of this delayed d...

Analysis fingers causes of desertification

...ors and feedbacks. Public and individual decisions leading to desertification largely respond to national-scale policies aimed at promoting advanced land-use technologies and creating new economic opportunities. ...

Study reveals first genetic step necessary for prostate cancer growth

...early intervention." Prostate cancer is the second leading cause of death for men in the United States. This year, more than 230,000 men will be diagnosed with the disease, in large part due to widespread screening with the prostate-specific antigen, or PSA, test. The test has been controversial because it c...

New imaging technology at Joslin shown to detect early signs of type 1 diabetes

...to the earliest stages of the inflammatory process leading to type 1 diabetes in laboratory animals. The new findings one day may be useful for predicting whether and when diabetes will develop in humans. Type 1 diabetes is an autoimmune disease in which the body's immune system mistakenly launches an at...

Disease diagnosis, drug development focus of UH prof's biochip research

...l aims of the conference are to bring together the leading academic and industrial researchers in the experimental and theoretical nanosciences, to showcase the role of computational science underpinning and enabling innovations, and to consider specific applications of nanotechnology. Conference proceeding...

Virginia Tech professor honored with DeLaval Award

... the opportunity to learn from some of the world's leading agricultural scientists. The college's comprehensive curriculum gives students a balanced education that ranges from food and fiber production to economics to human health. The college is a national leader in incorporating technology, biotechnology, ...

Winner of 2004 EMBO Science Writing Prize announced

...o combat the deadly 'Pseudo' bacteria currently a leading cause of hospital-acquired infections. Set in Hawaii, the exotic tale tells how Pond stumbles across the phenomenon of the glowing Bobtail Squid and learns how its quorum-sensing technology can be used in the fight against the Pseudo bacteria. Engl...

Advances in tumor angiogenesis Dendritic cells co-opted to the dark side

...rs in general," says Coukos. Ovarian cancer is the leading killer among gynecologic cancers, causing about 25,000 new cases a year and about 15,000 deaths annually in the U.S. "One of the problems is that it's diagnosed late and we don't have effective treatments for it. "Dendritic cells play a central role ...

The future of HIV therapeutics is brightening, according to Gladstone Institutes Director

...gen with only nine genes encoding 15 proteins, are leading to compelling new therapies that deny the initial entry of HIV into its cellular host. In addition, fast-moving research of naturally occurring factors with potent antiviral properties is opening the way for future development of an entirely new clas...

New tool predicts how long pollutants will stay in soil

...hanh Helen Nguyen, a graduate student who played a leading role in adapting the math tool and demonstrating its effectiveness. "For many years, we've made predictions with a method that doesn't work very well on many chemical pollutants in soil. This new tool does a much better job." Nguyen, who is working t...

Highlights of American Chemical Society national meeting in Philadelphia, Aug. 22-26

...the current spike in energy prices may just be the leading edge of this crisis. His presentation is part of a daylong Presidential symposium, "Fuels for the Future: Leading the Way with Chemistry." ( FUEL 112 , Tuesday, Aug. 24, 9:05 a.m.) Wednesday, Aug. 25 Pharmaceuticals and personal care products: Env...

Protein fishing in America: The movie

...flicker their lines against water, or so a current leading theory holds. The repeated weak slapping of protein surfaces against one-another is the critical first step in a chain of events that rule all subsequent cellular behavior. But this vital exchange between single molecules has defied direct observatio...

UC Irvine scientists to develop vaccine to combat bioterrorism threat from deadly bacteria

...t Asia and northern Australia. It is currently the leading cause of sepsis in northeastern Thailand, where infection rates are high during the rainy season since the bacterium thrives in water. Transmission occurs when humans and animals inhale dust bearing the bacteria, when they drink contaminated water, o...

OneWorld Health compiles comprehensive state of infectious diarrhea treatments, potential solutions

...ny would be shocked to learn that it is one of the leading causes of death among the developing world's children, responsible for approximately two million deaths each year. Even more shocking, diarrhea contributes to the death of four to six million people of all ages every year around the globe. The Insti...

2nd media alert First Scientific Conference on Childhood Leukaemia

...lable shortly CHILDREN with LEUKAEMIA is Britain's leading charity dedicated to the conquest of childhood leukaemia and it is organising the world's first conference devoted exclusively to the incidence, causes and prevention of childhood leukaemia. Many of the most prominent international names in leukaemia...

Researchers find clues about how antibodies specialize

...PA complex to go to the wrong regions, potentially leading to activation of cancer genes. "Now that we've learned how AID gets access to the variable regions, we can ask how the process goes awry to cause mutations of genes that could lead to cancer," says Alt. RPA is found throughout the body, and is kn...

Scientists reinvent DNA as template to produce organic molecules

...les, can encode three separate chemical reactions, leading to the multistep DNA-programmed synthesis of relatively complex cyclic products. Chemical synthesis occurs very differently in laboratories and in cells. Chemists typically work with molecules that react to form products when they randomly collide at...

Innovative 'ceramic-on-metal' hip replacements to undergo clinical trials

... Fisher of the School of Mechanical Engineering is leading the research. He says: "An increasing number of younger and active patients now need hip replacements, and are demanding better-performing artificial joints. These recent developments will lead to a ten-fold improvement in wear performance."...

Illustrated guidebook published for Chinese biomedical scientists and students

...ogy. And we are fortunate to have partnered with a leading Chinese publisher, Science Press of Beijing, to bring the book to the many scientists in mainland China who wish to improve their English skills. The publication of this book is one of several ways in which Cold Spring Harbor Laboratory is planning ...

Embryonic stem cell therapy shows steady benefits in rebuilding infarcted heart

...atment, cardiovascular disease is far and away the leading cause of death in the U.S. and the world. According to the latest posted statistics, heart disease causes 700,000 deaths in the U.S. each year, with the number of adults diagnosed with heart disease exceeding 23 million, or 11.5% of the adult popula...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker