Tag: "lecture" at biology news

Artificial lung on the horizon, reports University of Pittsburgh researcher at International Society for Heart and Lung Transplantation meeting

...oxic gases, he reported. In an invited keynote lecture at the 21st Annual Meeting of the International Society for Heart and Lung Transplantation, Brack Hattler, M.D., Ph.D., a professor of surgery at the University of Pittsburgh School of Medicine, said laboratory and animal studies suggest the device c...

Chemistry in the Amazon: Tropical birds, Amazonian tribespeople derive medicinal benefits from insects, plants

...riguez' remarks, part of the ACS eminent scientist lecture series, will highlight the interconnection between the conservation of biodiversity and the preservation of human and animal health. Rodriguez will discuss the evolution of natural organic chemicals from Amazonian plants to caterpillars, ants and...

Nanogen reports progress in development of electronic technology for high-throughput screening of protein kinases

...rch 12-16, 2001, and will also be the subject of a lecture at the Discovery 2001 show in San Diego on March 27, 2001. The electronic approaches demonstrated by Nanogen encompass microtiter-plate and MEMS applications and are designed with the intent of integrating Nanogens technology with current high-throu...

Award winners announced for 2001 Merck/AAAS undergraduate science

...orts, the awards may provide funding for symposia, lecture series and workshops. The Merck/AAAS program was launched in 1993 and, until this year, was limited to 12 northeastern/mid-Atlantic states. In 2001, however, the program was opened up to institutions around the country. The Merck Company Founda...

Award winners announced for 2001 Merck/AAAS undergraduate science research program

...orts, the awards may provide funding for symposia, lecture series and workshops. The Merck/AAAS program was launched in 1993 and, until this year, was limited to 12 northeastern/mid-Atlantic states. In 2001, however, the program was opened up to institutions around the country. The Merck Company Foundat...

Free sessions open to the public at 2001 AAAS Meeting

... Friday, Feb. 16 6:30 7:30 p.m. Plenary lecture by Karen Stephenson, president of Netform and the ...aturday, Feb. 17 6:30 7:30 p.m. Plenary lecture by Francis Collins, director, National Human Genome Research Institute, National Institutes of Healt...

Ecologist wins international award

...n will receive 100,000 French francs and deliver a lecture based on his work with longevity in Blanding's turtles, in July 2001 at the World Congress of Gerontology in Vancouver Canada. "It is an honor, and quite a surprise, be recognized by the Foundation IPSEN and scientists studying aging,? said Congdon....

Students learn mysteries of biological clocks at Howard Hughes Medical Institute's holiday lectures on December 4 and 5

...lidaylectures.org ) also offers teacher resources, lecture summaries and links to "virtual laboratories." Teachers who register in advance receive free guides to help them integrate the Holiday Lectures with their curricula. In addition to the Holiday Lectures features, HHMI's Web site at www.hhmi.org prov...

Faster coagulation rates found in natural systems could impact industrial processing

...ington, D. C. on Sunday, August 20. His keynote lecture is entitled, "Fractal Coagulation Processes. In his experiments, Logan added fluorescent beads to water already containing bacterial aggregates. The coagulation rate, or the rate at which the beads attached to the bacterial aggregates, was calcul...

Merck/AAAS Undergraduate Science Research Program expands to become national

... and chemistry. The awards also support symposia, lecture series and workshops designed to bridge the chemical and biological sciences. The program was launched in 1993 to promote undergraduate research experiences at the interface of chemistry and biology. The program emphasizes student engagement in r...

New research centre to continue 200-year-old traditions

...lanned to accommodate 32, with a field laboratory, lecture room, and display room among its facilities. The University is working closely with National Parks and Wildlife SA, who are partners in the design, construction and management of the Centre. National Parks and Wildlife SA are upgrading access roads, ...

Welch Award honors 2 for unlocking nature's secrets

...academic chairs in chemistry, organizes a visiting lecture series of prominent scientists, supports a summer scholar program for high school students, and helps fund a biennial conference for chemistry and science teachers at the high school and junior high levels....

'Science and Technology at the Millennium: Retrospect or Prospect' Focus of AAAS Science and Technology Colloquium, April 11-13 in Washington, DC

...e, Tuesday, April 11, 5:30 p.m.] Please note this lecture is free and open to the public. David J. Farber , Chief Technologist, Federal Communications Commission [Wednesday, April 12, 9:00 a.m.] Bill Joy , Co-founder, Chief Scientist, and Corporate Executive Officer, Sun Microsystems [Wednesday, April 1...

Press availability: J. Craig Venter, Genome Project Chief, available for media inquiries

...y Sunday, March 26, at 4 p.m. (PST), preceding his lecture at the 219th national meeting of the American Chemical Society, the world's largest scientific society, in San Francisco, Calif. Venter, co-founder of Rockville, Md.-based Celera, is renowned for having helped develop a new strategy for gene discov...

National prize in neuroscience endowed by UNC professor

...ibutors in the field to receive this award, give a lecture and interact with people here. The prize would be a legacy of my having been here and would help call attention to the institution and our strength in neuroscience." He added: "The concept is to recognize people with fresh and current contributions ...

Parsons preaches magnets

...ity, has been invited to Japan. He is to deliver a lecture on his pioneering work on anti-scale magnetic trea...cycling in October. Tom was invited to deliver his lecture at a strategic water conference that will influence the privatisation of water in South Korea. Tom's...

DBI News: Plant microbe interactions and nutrient use to be explored Nov. 16 at UD

...protein function, and plant molecular biology. Her lecture will focus on the interaction between legumes, such as soybeans and the alfalfa relative Medicago truncatula, and the bacterium Rhizobium, the basis for her current research program at the Delaware Biotechnology Institute. This unique cell-to-cel...

Director of Emory Vaccine Center to give Wistar Institute's 1999 Tadeusz J. Wiktor Memorial lecture

... the rabies vaccine used today. Dr. Ahmed's lecture is titled, "ImmuneMemory to Viruses." WHEN: Wednesday, November 3, 1999, 4:00 pm. WHERE: The Joseph N. Grossman, MD Auditorium The Wistar Institute 3601 Spruce Street Philadelphia, PA 19104-4268 Dr. Ahmed received his PhD in...

UMass virologist publishes book on "The Real Science Behind 'The X-Files'"

... to be announced. Simon is alsoscheduled to give a lecture on "The Science of the X-Files" at the SpringfieldMuseum of Science on Jan. 29, 2000....

Mountain Lake Hotel places environmental book in rooms

...r von Humboldt Foundation and a Fulbright award to lecture in Egypt andYugoslavia. He was an advisor to the U.S. Delegation at the First Conference onPeaceful Uses of Atomic Energy in Geneva and a member of the World HealthOrganization's Study Group on the Effect of Radiation on Human Heredity inCopenhagen. ...

1 2 3 4 5 6

(Date:5/23/2013)... (PRWEB) May 23, 2013 911 Signal USA ... expo will begin on May 22 and run through May ... and information about the company's emergency vehicle lights ... new 2013 Dodge Charger at the expo. , The Charger ... on the market and can be seen by visiting 911 ...
(Date:5/22/2013)... 2013 Most women dread cellulite and ... factors, including estrogen being a factor in the formation ... deposits stored and smashed together which create that dimpling ... take a multi-pronged action," says Kathy Heshelow, founder of ... products like Cellulite Whisperer ® that work to ...
(Date:5/22/2013)... Catalyst Exhibits, Inc., an award-winning global ... its website that allows visitors to view a ... immersive, 360-degree, interactive experience. , The new viewing ... virtually experience the exhibit design Catalyst created for St. ... Users have the ability to interact with the hi-resolution ...
(Date:5/22/2013)... San Francisco, CA (PRWEB) May 22, 2013 ... funerals costing $6,500 or more on average, a funeral concierge ... a funeral, among other benefits. Funeral Financials ... With the average household income in the U.S. ... recession according to Sentier Research, the average funeral costs 12.6% ...
(Date:5/22/2013)... MD (PRWEB) May 22, 2013 On a ... Lisa, spent a few hours watching “The Bourne Legacy” at ... While this may seem like a typical activity to many ... This little stretch of respite from their everyday reality has ... Seals Serving DC | MD | VA. , Life changed ...
Breaking Medicine News(10 mins):Health News:911 Signal USA Attends the 2013 Southwest Police Fleet Expo 2Health News:Get Cellulite Under Control Now with Cellulite Whisperer® Products Introduced by Sublime Beauty® 2Health News:Catalyst Exhibits Debuts 360 Degree Virtual Tour of St. Jude Medical Trade Show Booth 2Health News:Funeral Financials Announces Their Top 3 Reasons to Hire a Funeral Concierge 2Health News:Funeral Financials Announces Their Top 3 Reasons to Hire a Funeral Concierge 3Health News:Military Family Finds Respite with Easter Seals 2Health News:Military Family Finds Respite with Easter Seals 3
Other Tags
reversiblyswitchesmitslittlerappliesspecificityforeveraustraliansrelyfeversovertakemortemscarspresentingpodcastcore