Tag: "listing" at biology news

Journalists will get latest information at Addiction Studies Institute

...cussion forum for journalists and scientists and a listing of expert sources and how to contact them....

Wood dust, talc, estrogens, and nickel alloys among substances being reviewed for inclusion in Report on Carcinogens

...talc are among the substances being considered for listing in the next federal Report on Carcinogens. To ass... listings are as follows: Wood Dust, proposed for listing in the category of "known to be a human carcinogen," is associated with increases in cancer of the n...

Advisory panel on federal report on carcinogens makes recommendations to NIEHS/NTP for new listings

...he antibiotic chloramphenicol, was recommended for listing as "reasonably anticipated" to be a cause of human...15) in Washington, D.C. It also recommended for listing as "known" human carcinogens: -- Common wood dust produced while manufacturing furniture and cabinet...

ASM and TIGR team up on microbial genomes conference

...gun. They will be faced with an enormous database listing genetic sequences that must be deciphered to have any practical use. Fortunately, bacteria often contain genes similar to those found in humans, and scientists may already know what these genes do. The smaller, less complex genomes of microbes wil...

Free sessions open to the public at 2001 AAAS Meeting

...children as well as adults will enjoy. A complete listing of public activities is below. All sessions will be held at the Hilton San Francisco and Towers, 333 OFarrell Street, San Francisco, CA. The hotel phone number is 415-777-1400. Thursday, Feb. 15 5 6:30 p.m. The American Jun...

Amidst genome data, a practical tool for researchers

...tion of the "Book of Life," the working draft is a listing of the 3 billion DNA base pairs that carry genetic...evel is the genome sequence: the detailed, ordered listing of the chemical bases adenine, guanine, cytosine and thymine, which are the four members of the gene...

Federal government makes final call for data, public comment before writing new report on cancer-causing substances

...es evaluated available, published data relevant to listing these substances as "known" or, with less complete...ded for upgrading from "reasonably anticipated" to listing as a "known" human carcinogen by one government panel, the NIEHS Review Committee, but the upgrade w...

Remote sensing study defines "edgy" cities

...rabia; and Vancouver, British Columbia. A complete listing of all 100 cities to be studied can be found at http://elwood.la.asu.edu/grsl/UEM/tab1.html . ASTER obtains high-resolution (15 to 90 square meters per pixel) images of the Earth in 14 different wavelengths of the electromagnetic spectrum, ranging f...

Officials delay trade restrictions on Caspian Sea caviar

... have reiterated their plans to seek an Appendix I listing for beluga sturgeon, which under CITES guidelines would effectively place an international trade ban on beluga caviar. In addition, the three groups are calling on consumers worldwide to avoid beluga caviar and to reduce their consumption of other C...

NTP plans to look at common viruses, radiation, cooking by-products for new carcinogen report

...and a variety of industrial exposures for possible listing in the eleventh edition of the federal Report on Carcinogens , which will be published in 2004. The NTP, which is headquartered at the National Institute of Environmental Health Sciences , prepares such a report every two years. The report is man...

Whale of a Puget Sound problem lures UW researchers

As the federal government inches toward listing Puget Sound's orca whales for protection under the Endangered Species Act, University of Washington researchers have launched a multiyear effort to determine the cause of the marine mammals' plummeting population. Every morning since June, researche...

On California's Channel Islands, native predators became prey when feral pigs rearranged the food web

...o save the island fox, which has been proposed for listing as an endangered species. In addition to Latta's golden eagle relocation project, a pig eradication project is planned to start next year on Santa Cruz Island, in cooperation with the Nature Conservancy, which owns 76 percent of the island. Captive b...

Experts offer the skinny on search for healthy fat

...tWild.com . The Web site includes a state-by-state listing of grass-fed beef producers that sell to the public....

Wild jaguar photographed in Arizona

... listed in the U.S. as an endangered species; this listing does not entail a "critical habitat" designation, since habitat in the U.S. is not necessary for the jaguar's survival. "The WCS Jaguar Conservation Program is committed to the long-term conservation of jaguars in this borderland area. We intend to ...

Proliferation of Argentine ants in California linked to decline in coastal horned lizards

...n California, are candidates for federal and state listing because of their sharp declines, according to the scientists. "Horned lizards may be one of the few 'charismatic' reptiles people might care about in California," notes Fisher, who has been conducting a comprehensive survey of reptiles and amphib...

Labor-inducing folklore alive and well among pregnant women

... Schaffir gave each woman a questionnaire listing certain folk beliefs about hastening labor: frequent walking; having sex; heavy exercise; using a laxative, such as castor oil; nipple stimulation; eating spicy foods; fright; starvation; ha...

U.S. takes first step toward protecting endangered beluga sturgeon

...for the public to provide comments on its proposed listing of beluga sturgeon as an endangered species. Sturg...at it took a lawsuit to get the Service to propose listing beluga sturgeon," said Andrew Wetzler and attorney with NRDC. "Now that the Service has finally don...

Homeland security highlights from Pacific Northwest National Laboratory

...t is a hyperlinked report, including a prioritized listing of Web pages containing potentially strategic or sensitive information both within the user's organization and at externally linked sites....

International consortium launches genetic variation mapping project

...ally, researchers could hunt for genes using a map listing all 10 million SNPs, but there are major practical drawbacks to that approach. Instead, the HapMap will find the chunks into which the genome is organized, each of which may contain dozens of SNPs. Researchers then only need to detect a few tag SNPs...

2,000+ brown recluse spiders in a Kansas home inflict no bites in the occupants, UCR study notes

...//www.ucr.edu or by calling 909-787-5185. For a listing of faculty experts on a variety of topics, please visit http://mmr.ucr.edu/experts/ ....

1 2

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid