Tag: "mail" at biology news

Celebrity cloning

... DNA from your tongue onto the back of a stamp and mail it to yourself. Self-directed mail is often used by poets and writers to document the date of a work's creation and establish copyright...

Parasite offers natural way to control leaf-eating slugs

... someday be able to order live worms by overnight mail from commercial pest-control companies, as Europeans do today. A batch of several hundred tiny worms resembles a small pile of white cottony threads, he said. Instead of...

Study finds hemochromatosis patients' blood is as safe as other donated blood -- may help alleviate blood shortage

... of Blood Banks. The study involved an anonymous mail survey conducted in 1998 as part of The Retrovirus Epidemiology Donor Study (REDS). Survey respondents were from eight large U.S. blood centers. Of the 52, 650 blood donors who returned questionnaires, scientists identified 197 who reported a diagno...

Univ. of Fla. professor: Air cleaning system destroys Anthrax, other pathogens

...Service, one application would be to install it in mail sorting or collection areas, he said. This is affordable for people. A central system for a single-family house would probably be in the range of $1,000 to $1,500, he said.As part of UFs technology transfer mission, the technology was patented and li...

UC Berkeley expert on insect flight receives prestigious MacArthur 'genius' award

...was reached over the weekend by a cell phone voice mail while backpacking along the remote Na Pali coast of Hawaii. He had to scratch the foundation's phone number in the sand, but the cellphone shorted out in the dampness before he could call back. He finally contacted the foundation yesterday from a pay...

Anthrax - Trail of terror

...ax, says Alibek. He says sending the anthrax inthe mail is a "very primitive" way of distributing it, and suspects theattackers don't have much material to work with. We could soon know. Paul Keim's team at Northern Arizona University inFlagstaff has pioneered the genetic analysis of anthrax bacilli. Rece...

Media Advisory 2 - 2002 Ocean Sciences Meeting: press conferences scheduled

...apped. PIOs who cannot attend may send releases by mail or express service. Address them as follows: Harvey Leifert (Hold for February 9 arrival) Hilton Hawaiian village 2005 Kalia Road Honolulu, HI 96815 (Phone: 808-949-4321) Shipments should be timed to arrive by Saturday, February 9, for distribution t...

Could the FBI be doing more in the hunt for the anthrax attacker?

...HE attacker who sent anthrax spores through the US mail last autumn may not have stolen the powder made by the US Army's Dugway Proving Ground in Utah. If so, the attacker must have known how to "weaponise" the bug. That's the implication of what New Scientist has learned about the latest attempts to dis...

Statistical analysis of anthrax attack shows outbreak could have been twice as large

...lational anthrax through contact with contaminated mail and mail handling facilities in Florida, New Jersey, and Washington, D.C. The two remaining anthrax cases wer...

Mathematical model provides new tool to assess mail-borne spread of anthrax

...n be explained by contamination spread through the mail from six original envelopes. The analysis suggests...ude of the problem vaccination of all professional mail handlers may be advisable; The model provides a framework that can be used for the rapid identificat...

GSA Release 02-41: 2002 Geological Society of America Annual Meeting

...ing and are unable to attend, you may send them by mail or express delivery service for distribution in the GSA Newsroom. Materials may be shipped to the following address beginning October 26: Geological Society of America Christa Stratton, Room A206 C/O Freeman Decorating Company Colorado Convention Ce...

Agronomy, Crops and Soils Annual Meetings' papers, symposia searchable online

...essions and the Press Room. Please e-mail, fax, or mail your name, company, address, phone, and e-mail address to: Sara Procknow, ASA-CSSA-SSSA, 677 South Segoe Rd., Madison, WI 53711; e-mail: sprocknow@agronomy.org ; fax: 608-273-2021. A Press Room will be available at the Indiana Convention Center, Ro...

CAST releases report on environmental impacts of grazing systems on our nation's resources

...vember 12, 2002). Printed copies can be ordered by mail (CAST, 4420 W. Lincoln Way, Ames, Iowa 50014-3447), or e-mail: cast@cast-science.org . Issue Paper Background Occupying more acreage than any other single land type in the Unites States, grazing lands constitute more than 860 million acres (350 mill...

Ultrasound shown to be potentially safe, effective way to kill bacteria

...han the deadly anthrax spores found to contaminate mail last year. Bt, bacillus thuringiensis, is a common commercial insecticide and is also a close cousin of the anthrax bacillus. "Bacillus anthracis and bacillus thuringiensis are very close relatives," she adds. "They differ by only a few genes on the...

American Physical Society March Meeting 2003

...rica (H2); radiation processing in food packaging, mail handling, and bio-electrodes (B8); global infrasound monitoring in the atmosphere for studying volcanoes and weather (paper H3.2); assessing the value of physics research to the economy (session S2); superfluid gyroscopes (G4.2); single-molecule LEDs...

Discovery of size changes of Bacillus spores may lead to simpler, faster anthrax detector

...dospores, after anthrax spores began showing up in mail at spots around the East Coast. Both physicists had experience measuring microscopic objects during more than a decade spent searching for the minuscule tracks of cosmic rays in special glasses and of interplanetary dust grains in aerogels, and more ...

Researchers respond to threat, look for anthrax

...esearchers is working on a system that will sample mail for airborne contaminants, such as anthrax spores,...agents sent through the mail. "We have full-scale mail sorting machines that generate background dust - just as you would find in a real sorting facility,"...

Forensics bringing bacteria into the courtroom

...train. But the recent anthrax attacks on the U.S. mail system raise a number of questions. If an individual were charged with the attacks, would the court be willing to convict him or her, using as evidence a variation in a genome sequence? Salyers, a professor of microbiology at the University of Illino...

JCI Table of Contents, April 1, 2003

...Dept. Of Medicine General Clinical Research Center mail code #3805 263 Farmington Avenue Farmington, CT 06032 USA Phone: 1-860-679-2129 Fax: 1-860-679-1258 E-mail: raisz@nso.uchc.edu View the PDF of this commentary at: https://www.the-jci.org/press/18235.pdf WNK Kinases Regulate Thiazide-Sensitive N...

Diet study focus of TAES research in effort to help save giant panda

...l be collected at the Memphis Zoo and delivered by mail to the GANLAB in College Station. There they will be analyzed using Near Infrared Reflectance Spectroscopy, which measures chemical bonds in a variety of organic compounds. Researchers hope it will lead to more accurate and immediate information abou...

1 2 3

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting