Tag: "mammal" at biology news

Earliest evidence of lemurs discovered in Pakistan, far from their current home, Science reports

...th, weighing in at close to 20 tons. "This amazing mammal probably ate more than a ton of leaves and other things per day, and shared the same paleoenvironment and paleoconditions with the minute Bugtilemur ," says Marivaux. Marivaux says that future fieldwork at Bugti Hills, the site of paleontological in...

APS August/September journal hot picks

...SEP, and functional studies suggest that sBSEP and mammal BSEPs have identical properties, it is likely that the non-conserved sequences may not be essential for targeting. The possibility that sBSEP is misfolded and prone to degradation is also suggested and a comparative functional genomics approach shoul...

Surprising link between body size and extinction risk

...ink between size and extinction risk: the smallest mammal species are the least vulnerable to extinction. Many Australian rodents weigh less than an ounce and some marsupials weigh less than a third of an ounce. Cardillo and Bromham speculate that these small species are more robust because they have high p...

Most eastern North American reserves too small

...reserves studied were in the Alleghenian-Illinoian mammal province, which encompasses the northeast quadrant...future development isolates other reserves in this mammal province, they could also lose species. To estimate the smallest size these reserves could be withou...

Harbor Branch scientist aids in Mexico manatee rescue effort

...l, thanks to the efforts of a HARBOR BRANCH marine mammal expert who helped to rescue them and arrange for their thousand-mile journey to a new home. Dr. Greg Bossart, head of Marine Mammal Research and Conservation at HARBOR BRANCH Oceanographic Institution, was asked by the Mexican government to travel to...

Kangaroo, platypus are not related after all; Duke scientists refute current molecular method of classifying mammals

... biologists apply the information learned from one mammal to others in the same class, without having to con...so that you can make accurate inferences about one mammal from another mammal's development." In recent years, scientists have increasingly relied on usin...

Web key helps researchers identify mammals

...elies on a full set of images to differentiate one mammal from another. This differs from the traditional textbook approach, which relies on the written descriptions for identification. Finally, it is easier to update a Web-based guide with new findings than to update a textbook. The Field Museum does not h...

July media highlights: GEOLOGY and GSA TODAY

...outhwestern Amazonia and confirm the presence of a mammal derived from North American ancestors in South America more than 9 Ma. This mammalan extinct, elephant-like gomphotherethus becomes the first known participant in the late Cenozoic faunal exchange between the two continents. From the younger ash ag...

Humans hunted mammals to extinction in North America

...til it was too late. More than half of the large mammal biota of the Americas disappeared in a cataclysmic extinction wave at the very end of the Pleistocene, begins Alroy in the Science article. Some of the mammals that became extinct are: woolly mammoths Columbian mammoths American mastod...

Montana drought sends paleontologists to field early for largest project in state's history

...geology. They include paleobotanists, a Cretaceous mammal expert and an invertebrate specialist. The early end to this year's field season will have an additional benefit beyond the hope that workers will be able to complete their work, Leiggi continued. It will also give the MSU people time to continue wo...

What it means to be a mammal: New clues from tiny fossil described in Science

...the journal Science suggests that this miniature mammal relative is the closest known relative to the livi...90 skeletal features in Hadrocodium , other early mammal fossils, and the living mammals, and their analysis suggests that the new species is the closest kno...

Field Museum plays vital role in creation of huge new park

...ecies in the region. In addition, they recorded 71 mammal species (13 of which are endangered); 500 bird species; and 82 amphibian and reptilian species. RBI quick and accurate study The purpose of an RBI is to quickly assess the flora and fauna of a threatened environmental area. Local and international...

Ticks have potential to transmit cat scratch disease

...ycle, as a larva or nymph, by feeding on a smaller mammal (such as a rat) or even a lizard. The second is the possibility of vertical transmission. An infected female could have had the bacteria in her ovaries and passed it on to her offspring. More research is necessary to understand the origin of the ...

Anthropologists find evidence of early humans in southern China cave

...another analysis that supports the idea that large mammal teeth were brought into the cave. She was examining the evidence for the "schlepp effect" at Dadong. The "schlepp effect" refers to the tendency for humans to only transport useful parts of animals back to their home bases. As the legs are the portio...

Speaking of sperm whales

...y challenging," says Dr. Bob Gisiner, ONR's marine mammal expert, "But it's a highly effective way to determine if, and at what scale large wide-ranging species like whales might be affected by manmade sounds from activities like geophysical exploration. ONR is helping with the acoustics expertise." Last su...

A first: A (nearly) complete road map for the evolution of placental mammals

... to great hope that weve nearly resolved placental mammal history." Scientists have been trying to sort out ...exploring the evolutionary history of this or that mammal or mammal group using one method or another, it sought to address the question for all placental mam...

Baylor College of Medicine garners research grants to sequence rat genome

...ion, to determine the genetic makeup of the rat, a mammal often studied in medical and behavioral research. We are extremely pleased by these awards, especially the confidence that Dr. Francis Collins, NHGRI director, and Kleberg Foundations President Helen Groves have in our abilities to efficiently s...

DNA deletion offers new evidence of mammals' origins

...s, and hyraxes to boot. "One of the problems with mammal phylogenies is there hasn't been a lot known," explained DeBry. "We were searching for the basic outline of the tree of life." Traditional phylogenies, or evolutionary trees, were based on fossil evidence and physical similarities. To complicate thi...

How wild horses were tamed by humans is uncovered by biologists from UCLA, Swedish universities

...ld. Horses are believed to be among the last large mammal to be domesticated, presumably, Wayne said, because of their abundance in the wild. Domestic dogs, cattle, sheep and goats were established several thousand years before the horse was domesticated. Similar DNA analyses of cattle, sheep, water buffalo...

Scientists launch the worlds first marine life census

... studied; and the northern elephant seal, a marine mammal that has been the subject of intense research for nearly 30 years. Other animals selected for the pilot project were blue sharks, albatrosses (the largest seabird), salmon sharks, leatherback turtles, yellowfin tuna, blue whales and loggerhead turtle...

1 2 3 4 5 6 7

(Date:8/22/2014)... (PRWEB) August 22, 2014 A new, online ... connection. The summit is no-cost and open to everyone. ... kept secrets, practical tips and advice on how to stop ... or manage weight. Mindful eating is not a diet. ... stay motivated instead of an "eat this, don't eat that" ...
(Date:8/22/2014)... who need surgery for facial pain caused by trigeminal ... used, reports a study in the September issue of ... Congress of Neurological Surgeons . The journal is ... part of Wolters Kluwer Health . , Percutaneous ... lower cost than other types of surgical treatments for ...
(Date:8/22/2014)... Ticket Down is a reliable source for ... Albuquerque and Rapid City. For fans looking to speak with ... allows just that. Caputo was born and raised in Hicksville, ... knit family who began to see spirits when she was ... had a chance to do what most people wished they ...
(Date:8/22/2014)... 2014 Pirate Jonny's Caribbean ... in providing new recipe cards, fun t-shirts, and caps ... Hailing from Clearwater, Florida, Pirate Jonny, aka, Jonathan Toner, ... with two to three recipes featuring different flavors of ... on the website. The recipe cards will feature ...
(Date:8/22/2014)... According to the new research ... Global Trends & Forecast to 2019" defines and ... forecast of the market value. The isocyanate material ... 2019, at a significant CAGR from 2014 to ... 44 figures spread through 286 pages and in-depth ...
Breaking Medicine News(10 mins):Health News:20 Top Experts Discuss How to Unravel the Food-Mood Connection 2Health News:More common procedures for painful facial tics carry high costs, reports study in Neurosurgery 2Health News:Theresa Caputo Tickets in Kalamazoo at Wings Stadium, Saenger Theatre in New Orleans, Kiva Auditorium in Albuquerque and Rapid City at Don Barnett Arena Now Available 2Health News:Pirate Jonny's Caribbean BBQ Rubs, Seasonings & Sauces Get New Look by Hoisting New Recipe Card Creations and New Clothing Apparel for its Logos 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 3Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills