Tag: "map" at biology news

Penn researchers explore the role of cell suicide in the development and treatment of cancer

...of the mechanism function, the researchers hope to map out new ways to correct for the mechanism when it fails. To look at it broadly, there are only two major types of diseases: ones where cells are killed and ones where cells refuse to die, said Thompson. Cancer is one of the latter it occurs when di...

GIS, bioinformatics collaborations offer promising new perspectives

...BI) Director Bruno Sobral agreed. "The notion of a map goes all the way from the level of a genome to a map of the United States," he said. "Bioinformatics has focused on modeling from the level of the molecu...

Ohio State genome map

... researchers have produced a third map of the human genome, this one ... Genome Project, the federally funded effort to map the genome, published their findings in the prestigious journals Science and ...

Global consortium announces plans to sequence banana genome

...cause of death in African cattle. Scientists will map the banana genome using a sexually reproducing wild species of banana from Southeast Asia. "Banana will be the first exclusively tropical crop to be sequenced," said Frison. "More than a popular snack, bananas are a staple food that many African ...

Cystic fibrosis patients show too little salt in lungs, will need long-lasting treatments

...f medicine at UNC. This work presents a clear road map showing which fork we need to take to develop better treatments for CF lung disease. What remains is largely an engineering problem. A report on the research appears in the July 20 issue of Molecular Cell, a major scientific journal. Besides Boucher,...

Scientists map the complete genome of an important agricultural bacterium

...isms on Earth. Researchers say that the new genome map could provide the foundation for improving crop yi...obium meliloti, in 1998. Their results a complete map of the S. meliloti genome appear in the July 27 issue of the journal Science. S. meliloti is one o...

Monsanto and researchers celebrate first anniversary of sharing rice genome sequence data

...ld further facilitate the completion of a physical map for the rice genome." In addition to sharing its data with the IRGSP, Monsanto established a rice genome database at www.rice-research.org, which makes the data available at no charge, mainly to publicly funded researchers. Since the database was e...

New study puts dinosaur noses in their place

...ssils from dozens of dinosaurs, Witmer was able to map the likely position of cartilage, blood vessels and other soft tissues that made up the nasal cavity of dinosaurs. "We looked at as many modern-day animals as we could get a hold of," Witmer said, "and found an extraordinary amount of evidence to su...

UCSD biologists identify genetic mechanism conferring resistance to 'Bt toxins'

...s Aroian. "We have a complete genetic and physical map of C. elegans, we can breed them in the laboratory easily, they grow fast, having only a three-and-a-half day life cycle, theyre transparent, so we can easily see their internal structures and they eat bacteria, so we can express the Bt toxin rig...

Trouble in paradise? 'Natural' pest control requires careful planning, Science authors conclude

...orphose into winged insects. Researchers wanted to map out exactly who eats what, to keep track of the real impact of non-native species on the Hawaiian island of Kauai. The food webs, which drew lines between the three members of the food webplants, Lepidoptera and parasitoidsprovide scientists with r...

Better computer modeling provides a new look at large biomolecules

...s and the other with 94,854, revealed an intricate map of positive and negative potential that could yield insights into the function of ribosomes, said the scientists. According to McCammon, software using the new approach will soon be made available to experimental molecular biologists to help guide th...

Supercomputer paints electric landscape of cellular structures

...d colchicine may bind. Likewise, the electrostatic map of the ribosome revealed an area on the smaller 30s subunit that may play roles in stabilizing tRNA and mRNA during translation....

New epilepsy gene identified in mice

... search, Ptacek and his colleagues then set out to map this locus finely enough to identify the specific causative gene. "It was just a matter of brute force, in which we generated a colony of twelve hundred mice and performed genotyping on them to home in on the gene," said Ptacek. "Eventually, we local...

Rutgers scientists mapping DNA links to complex diseases

...uter research team is developing a genetic linkage map that may help scientists eventually pinpoint the D...hen completed by the end of this year, the linkage map will be published and made available free of charge to the biomedical community, according to its sp...

Research season will feature use of sophisticated technologies to map Antarctica

Researchers plan to map the surface of the vast Antarctic ice sheet with airborne radar, measure the movement of the Earth's crust beneath the ice with Global Positioning System transceivers and deploy buoys to explore the waters off the Antarctic Peninsula when the U.S. An...

Researchers build diagram of cell cycle clock

... technique called genome-wide location analysis to map the circuitry underlying many fundamental life processes," says Young, whose lab developed this technique six months ago. "We now have a technique to connect the control switches that make up the network for any living process you can think ofmemory,...

Researchers uncover a piece of nature's secret nitrogen formula

...oms' layout. The complex process is like trying to map the position of crystals in the chandelier by looking only at their scattered reflections. When the computer had finished mapping the results, it had a surprise waiting. "When Jeremy and I looked at the analysis, we saw a nitrogen molecule stuck to i...

NSF awards $55 million in grants to study biocomplexity in the environment

...mal ecosystems; and developing portable devices to map the distribution of arsenic in groundwater in Bangladesh....

Researchers find gene for rare disorder that paralyzes children's legs

...istory of HSP. By sequencing the gene, they made a map of the DNA "letters", or nucleotides, in the specific order found in each affected and normal person. In three families, they found a one-letter "missense" mutation, in a position on the gene unique to that family but possessed by every member of th...

NSF awards University of Georgia $8.7 million for crop genetics research

...project goal will be to develop a sorghum physical map that shows the actual location of genes and other markers on the chromosomes and includes a wide variety other data. Patersons lab also will study sugarcane, which is a close relative of sorghum, as part of a collaborative effort with a Brazilian sug...

1 2 3 4 5 6 7 8 9 10

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting