Tag: "membranes" at biology news

Researchers determine genetic cause of Timothy syndrome

...hannels are pore-like proteins that nestle in cell membranes and control the flow of calcium into and out of the cell. Calcium is one of the most important signaling molecules in the body, and perturbing calcium transport can cause a wide range of disorders. Howard Hughes Medical Institute investigator Mar...

Researchers find color sensitive atomic switch in bacteria

...nce in the genomic era is the crucial role of cell membranes in normal cell function and disease states," said ...roteins on human cells and many antibiotics target membranes on pathogens....

Researchers create nanotubes that change colors, form 'nanocarpet' and kill bacteria

... salt group, known for its ability to disrupt cell membranes and cause cell death, with a hydrocarbon diacetyle...e, the researchers observed the tubes piercing the membranes of the bacteria like a needle being inserted into the cell. Both the polymerized (those that can cha...

Key cell-death step found

...ondria. They saw two distinct stages. First, outer membranes joined, creating an intermediate structure with on...lding two sets of inner membranes. Then, the inner membranes fused. The researchers also were able to investigate some of the biochemical requirements for the pr...

Genetic modification of linseed produces healthier omega 3 and 6 fatty acids

...carbon chain. They are essential components of the membranes of all living organisms. Fatty acid chains that are linked by single bonds between carbon atoms are said to be "saturated" by hydrogen atoms, whereas the introduction of double bonds between carbon atoms leads to correspondingly fewer bonds to hydrog...

There and back again

... momentarily and reversibly disrupting their outer membranes by the application of a tiny electrical current, a process called electroporation. This technology allowed the team to track cells that had been electroporated with the mutant forms of Cdc42 and observe as they contributed to somite formation. Elect...

Proteins show promise for mosquito control

... human arteries, is an important component of cell membranes in vertebrates and invertebrates. In mosquitoes, it is vital for growth, development and egg production. Unlike humans, mosquitoes cannot synthesize cholesterol. They must obtain it from decomposed plants they eat while in their larval stage, livin...

Two Virginia Tech energy-related inventions win R&D 100 awards

...have included the FAX machine and HDTV. Polymer membranes make fuel cell production economically viable M...or commercialization -- introducing Battellion TM membranes for automotive, stationary, and portable power fuel cells. Fuel cells convert chemical ene...

Cell's gatekeeper for ammonia revealed in unprecedented detail

...sociated. While some ammonia can pass through cell membranes without any assistance from a protein channel, the ammonia channel is extraordinarily efficient at transporting ammonia -- a trait called "high affinity" that can be critical since the ammonia is highly toxic, Stroud said. Many neurological disorders...

Battle between bubbles might have started evolution

...l genetic machinery that actively synthesized cell membranes or otherwise influenced cell stability or division...Cells are basically sacs encapsulated by bilayered membranes of fatty acids and other lipids, plus proteins. A central question in evolution is how simple versio...

Diabodies act as guided missiles targeted to mammary tumor growth

...aid. Using the HER2 receptor protein on tumor cell membranes as a portal into the cells, the radioactive diabody gained access inside tumors to induce cell death and restrict tumor growth. Although radioactive C6.5K-A was effective against the human mammary tumors growing in mice, the biotherapeutic fell shor...

Muscles are smarter than you think

... the influence of chloride, which helps the muscle membranes stay excitable.' 'It is a very clever trick because rested muscles need the chloride effect normally to prevent them spontaneously contracting. The acidity produced by the strenuous exercise reduces chloride's stabilising effect, enabling the impulse...

New UCF researchers, college will help fight Alzheimer's disease, cancer

...ntery and other diseases from getting through cell membranes and into the cells, where they cause diarrhea and other health problems. Learning how to best block that movement can help produce better drugs to fight those diseases, which are common in Third World countries, and other illnesses such as cystic fi...

Pump failure implicated in a form of dystonia

...protein that pumps sodium and potassium across the membranes of neurons have been implicated in a rare but deva... enzyme that pumps sodium and potassium across the membranes of neurons, using the energy of ATP to do so. Such transport is critical to maintaining the gradient...

Carnegie Mellon neuroscientist develops tool to image brain function at the cellular level

...on using another technique, it requires disrupting membranes and disturbing connections between nerve cells. Barth's method circumvents these drawbacks, allowing scientists to study living neurons at the cellular level. Using the fosGFP mouse to identify a discrete area of the brain involved in inputting senso...

UCSD biologists discover cell's defense mechanism against class of disease-causing bacterial toxins

... secrete toxins in order to form tiny holes in the membranes of the cells they infect. Scientists estimate that such "pore-forming" bacterial toxins account for approximately one-quarter of the known protein "virulence factors" that increase the infection and severity of a bacterial-caused disease. "For the ...

Protein controls acid in cells by direct detection of volume changes, study finds

... show that the protein NHE1, which is found in the membranes of nearly all cells and is especially active in cancer cells, is regulated by the stretch and pull of the membrane as a cell changes volume. The study appears in the Proceedings of the National Academy of Sciences and is available online. NHE1, which...

Finding the hole in the defenses of cavity-creating microbes

... of its success? The bacterium rearranges its cell membranes to make itself impervious to the acid assault that...her bacteria have the ability to change their cell membranes to cope with harsh conditions. E. coli bacteria happily ensconced in red meat perform a similar tric...

Medical implants work better when you rough them up, study finds

...microscope to determine the distance between cell membranes and disk surfaces. The distance between the fibrob...ry small, on the order of nanometers between cell membranes and the surface of a smooth disk. "Texturing provided a strong adherence between the surface of a ce...

Genetic modification in mice lowers cholesterol and homocysteine by half

...hatidylcholine(PC), the key building block of cell membranes in humans and other animals - and an important component of the HDL and LDL lipoproteins that carry fat and cholesterol in the blood stream. The CT pathway contributes about 70 percent of the PC in the liver and the PEMT pathway contributes the ot...

1 2 3 4 5 6 7 8 9 10

(Date:5/19/2013)... York, New York (PRWEB) May 19, 2013 ... that a Case Management Conference was recently convened for ... a federal multidistrict litigation now underway in U.S. District ... posted on the Court’s website on May 14th, the ... It was also reported during the Conference that ...
(Date:5/19/2013)... 2013 The Fat Loss Code program developed ... that help people get in shape, and gain a ... The program also is a natural fat loss system that ... author of this fat loss diet program claimed that The ... help people keep body fat off long-term. After Shawn Stevenson ...
(Date:5/19/2013)... Exciting new Skin Brushes are available ... great practice known through the ages but is a ... body brushing, has so many benefits for our health ... "We love that circulation and lymphatic systems get a ... skin, is supported through Skin Brushing." , Why is ...
(Date:5/19/2013)... 2013 The AMTC team will be screening ... Georgia Convention & Trade Center on June 1st. Professionals and ... auditions are free of charge. , Actors, Models and Talent ... of successful artists and grads like Caitlin Kinney - SYTYCD, ... , Chris Young - on his Liquid Neon 2013 Tour, ...
(Date:5/19/2013)... OH (PRWEB) May 19, 2013 The ... continue to follow developments in the nation’s first trial ... case, underway in Washington State Superior Court, was filed ... years after he suffered complications in a robot-assisted prostate ... The Da Vinci robotic surgery lawsuit alleges ...
Breaking Medicine News(10 mins):Health News:Pradaxa Lawyers at Bernstein Liebhard LLP Report on Recent Status Conference in Federal Pradaxa Litigation 2Health News:Pradaxa Lawyers at Bernstein Liebhard LLP Report on Recent Status Conference in Federal Pradaxa Litigation 3Health News:Weight Loss Secrets | How “The Fat Loss Code” Helps People Gain A Healthy Life And Get In Shape - Health Review 2Health News:Exciting New Skin Brushes at Sublime Beauty® Bring Health and Beauty Benefits; Celebrities and Models Know the Secret 2Health News:Actors, Models and Talent for Christ Hosting Auditions in Columbus, GA June 1st in Search of Local Talent 2Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 2Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 3Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 4
Other Tags
manageradoptionhysteriagrapplingbrewsphysicistsmillipedescavemassesremovingcompletelyappropriatewiperelativelycursorsmalarial