Tag: "microscopes" at biology news

Cornell Researchers Precisely Date Wood From Ancient Tomb In Turkey

...Pinned on the walls of a narrow lab cluttered with microscopes and maps, books and statues, computers and cabinets filled with charcoal samples, are long colored strips of paper depicting various chronologies. One orange strip on the wall runs from circa 500 B.C. to 50 A.D.; a blue strip pasted below begins at ...

Surprising Protein Movement Seen In Cells

...ent. Then, researchers used special laser-operated microscopes tofollow the movement of the proteins inside the cell. The Golgi apparatus processes and packages molecules needed for amultitude of functions. The biologists were surprised todiscover that the proteins move fast enough to traverse theorganelle with...

New Sensor Provides First Instant Test For Toxic E. coli Organism

...nt (with the use of a variety of toolsranging from microscopes to dyes.) Another detection technique, now underdevelopment, relies on polymerase chain reaction technology to multiply theamount of bacterial DNA present in a sample to detectable levels. Several hours must pass, however, before results can be obta...

Microsurgery Made More Accurate With Virtual Measuring Tool

... V. Discussion In general, stereoscopic operating microscopes allow for added depth perception through retinal disparity cues not provided by monoscopic display systems. In spite of this, however, the problem of measuring absolute distances and dimensions remains. When combined with stereo-computer graphics, on...

Summer Science: Where Have All The Honeybees Gone? UD 'Bee Guy' Asks Why--From America To The Amazon

...a longer-term solution, Camazine uses high-powered microscopes andother laboratory instruments to learn exactly how mites and their viruses affectbees. Strategies for addressing these problems may include breeding hardier beesand improved mite treatments, he says. At the USDA, for instance, scientists areinvesti...

U-M and Israel launch major international cancer study

...attery of tests on thetumor samples using standard microscopes and high tech molecular tools thatmagnify genetic material. Gruber summarized the goals of the project: "We would like to find better toolsto lower the risk of colorectal cancer with this study. Clarifying how genes,lifestyle, and environmental fac...

CWRU physicists invent "supershielding" for MRI devices

...cept in all other applications, such as electronic microscopes or microelectromechanical systems (MEMS). "Everyone is trying to take smaller and smaller computer chips and pack them closer and closer together. The need to shieldthem from each other becomes more acute," says Brown. The supershielding concept can ...

Study: calcium channels regulate cell movement

...ployed video microscopy, a technology that marries microscopes totelevision cameras, to study movement of the keratocyte cells. The technology revealed that the molecular machinery inside those cellsexerted perfectly coordinated and graded extension pressures along the fronthalf of the cell membrane whil...

Digital plant doctor diagnoses plant problems

... equip county agents with digital stereoscopes and microscopes toproduce more accurate, detailed images for diagnosis....

Protein component apparently plays key role in muscle elasticity

...dvanced Science and Technology. Using atomic force microscopes and advanced computer-driven simulations, researchers found that the hydrogen bonds allow all folded subsections (immunoglobulin domains) of titin to stretch by about 6 angstroms and still return to a normal state. Beyond that, the bonds will ruptur...

"Remote control research" a first for the U of L and National Research Council

...e, condensed matter physicists use "spectroscopic" microscopes such as NMR spectroscopy to study the structure of matter on a molecular scale. Siminovitch, a biophysicist who uses NMR spectroscopy to study bio-molecular structure and dynamics, has a particular interest in the function of proteins and peptides in...

Study: fertilized lakes less stable than previously thought

...tanist might analyze tree rings. Instead of using microscopes to identify the algae, the scientists used high-performance liquid chromatography to determine what kinds of algae were present, and how abundant they were, in sediment layers for every year from 1943 to 1990. Humans contribute to fertilization of...

Bio-X grant recipient explores link between molecular chaperones and serious diseases

...led single-molecule spectroscopy, in which lasers, microscopes and ultrasensitive detectors follow one copy of the molecule of interest at a time. ``When this is done,`` she wrote, ``we can actually see how each copy of the protein may march to a different drummer. This is equivalent to watching just one danc...

Ion microscopy pinpoints drugs inside cancer cells

...l markers, known as elemental tags, that allow ion microscopes to judge their efficacy. Chandra was the lead author of a report on the development of the biological and biomedical application of ion microscopy earlier this year in the journal Analytical Chemistry . The subcellular location of transported ...

Target cells found to play active role in synapse formation

...stroying them. The technique, Chiba said, allowed microscopes to zoom in on the difficult-to-capture interaction of cells communicating in the central nervous system. Time-lapse photography clearly showed the myopodia, only in the presence of axons, appearing to cluster to the filopodia, as if building a lif...

Human reproductive success tied to mitochondrial organization in eggs

...ach cell division in developing eggs with powerful microscopes in order to help them select the most viable embryos for implantation. Studies have shown fertilization and egg implantation success is higher if the blood flow through the tiny follicle vessels to the egg is strong and steady. CRE researchers use u...

New U. of Colorado electron microscopes provide cell images never seen before

...der has acquired two new state-of-the-art electron microscopes and a suite of complementing computers that are pr...e facility. "What makes the addition of these new microscopes important is that we are able to image portions of cells in three dimensions at a resolution that ha...

UC Berkeley researchers are developing a microsized microscope that can peek inside living cells

...or. With a significant development in miniaturized microscopes at the University of California, Berkeley, scienti... Lee. The high cost of owning and running confocal microscopes limits the amount of research that can be done with them, he said. "My goal is to not only shrink t...

Microscopy turning nanoscopy

... well as the atomic force microscope. Today, these microscopes have an extremely high performance and a high enou...ion to display features on a molecular level. Such microscopes tend have one crucial drawback however, insofar as they are usually limited to viewing the surface o...

Satellite data to predict plankton blooms by analyzing ocean color

...ous research on spring blooms was done at sea with microscopes and other tools. But by using satellites, Siegel and Yoder were able to evaluate the process using tens of thousands of data points, rather than just a few. One advantage provided by satellite ocean color data is measurements that cover the ent...

1 2 3

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement