Tag: "migration" at biology news

Operation Dangling Dino

... may also represent a new species or hold clues to migration patterns of these animals. Once airlifted and transported by truck to the Utah Museum of Natural History at the University of Utah in Salt Lake City, museum paleontologists will work to unlock the evidence within the fossilized bones. After the p...

Genes expose secrets of sex on the side

...ave developed new insights into ancient mating and migration patterns in humans. Men and women differed in t... Previous explanations of women and men's migration patterns had been based on a combination of genetic patterns and knowledge about the marriage practi...

IBD (Crohn's, Colitis) 'joins' cancer, inflammatory diseases in associated blood vessel growth

...extracts was tested in vitro by induction of HIMEC migration (cells/field) and in vivo by the mouse corneal ang...dy (Vitaxin) induced marked HIMEC apoptosis. HIMEC migration was dose-dependently induced by both CD and UC mucosal extracts, and was significantly greater than ...

Breaking new ground in germ cell guidance

... , describing an intriguing new model of germ cell migration involving a pair of guidance molecules, Wunen and ...ls indicated that they began their development and migration normally, and that their deaths did not display a significant increase in the molecular activity mos...

Adaptive changes in the genome may provide insight into the genetics of complex disease

...to 50,000 years ago. "Our results suggest that the migration of humans out of Africa into newenvironments was accompanied by genetic adaptations to emergent selectiveforces," said Dr. Joshua Akey, lead author of the paper and an assistantprofessor in the Department of Genome Sciences at the University ofWashin...

Maine-based biophysics institute gets funding for first US-based 4Pi nanoscale microscope

... discovery at MMCRI indicates that controlling the migration of fibroblast growth factor can prevent reocclusion of coronary arteries after angioplasty. We are confident that this fruitful collaboration with the physicists in the IMB will reveal many as yet unsuspected discoveries of value to the medical commu...

Probing the surface of white blood cells to enhance immune system medicine

...ts of the body. Similarly, by thwarting lymphocyte migration to deposits of cholesterol in coronary arteries, drugs could prevent the atherosclerosis that leads to heart attacks. Higgs extended this work to compare lymphocytes in patients with Wiskott-Aldrich syndrome, a hereditary immune disorder that affects...

UCR earns $1.5 million grant to examine how engineered crop genes stray

...may be able to find ways to control the unintended migration of transgenes and thereby harness the benefits of this new technology," Sutch said. "Alternatively, we may discover that the risk cannot be reduced to acceptable levels for certain combinations of crops and genes." Steven Angle, dean of the College ...

Joslin Diabetes Center launches research section on developmental and stem cell biology

...University School of Medicine. She is studying the migration and function of blood-forming stem cells, which are capable of regenerating the entire blood system and one of the only types of stem cells currently used through bone marrow transplantation for the treatment of human diseases (including leukemia, ly...

Endangered turtles' trek along ocean currents revealed by satellite

...vation. Pacific leatherbacks follow narrow migration corridors. Researchers hoped that if their Atlanti...ns, the Atlantic leatherbacks do not follow narrow migration corridors but disperse widely - to begin with, the leatherbacks carry out long nearly straight migra...

JCI table of contents, 2 August, 2004

...n neural regeneration. There was also evidence of migration of nerve progenitors into the region of stroke damage. The mice that were treated with CD34+ cells showed improved behavioral characteristics. Of note, if blockers to blood vessel growth were given in addition to the CD34+ cells, all of the benefit...

Stroking up cellular therapy

...n neural regeneration. There was also evidence of migration of nerve progenitors into the region of stroke damage. The mice that were treated with CD34+ cells showed improved behavioral characteristics. Of note, if blockers to blood vessel growth were given in addition to the CD34+ cells, all of the benefit...

Warmer weather, human disturbances interact to change forests

...gging and fragmentation would affect the northward migration of southern species during a period of climate warming." Although scientists know that species migration occurs as the climate changes - there is evidence of this from the last ice age, Scheller says - for...

NRH1 and Wnt signaling come together in convergent extension

...olecules that function in the survival, growth and migration of neurons.) However, on testing its affinity for neurotrophin ligands, the group found that, unlike p75NTR, NRH1 did not bind with neurotrophins, which led them to seek other biological roles for the protein. Experiments in which NRH1 was overexpres...

Scientists identify molecular link driving spread of skin cancer

... cellular interaction, significantly deterring the migration of cancer cells beyond the original tumor site. Blocking this protein linkage also was shown to inhibit angiogenesis--the creation of blood vessels that nourish new, secondary tumors--and spur cell death or apoptosis. The results, published in the J...

Cell death protein has surprising role in cell migration

...ned to normal. "The idea is simple -- if the cell migration problem improved, the overexpressed gene must have..., Geisbrecht determined that IAP's effects on cell migration stem not from its previously known role in preventing cell death, but from its ability to bind to an...

Sleepless over Seattle: Migrating songbirds forgo sleep but keep their wits

...hrough tests of their learning ability. During the migration periods, the birds performed normally on little sleep, but during the times of year when they were not migrating, sleep deprivation seemed to hurt the birds' performance. These results suggest that migrating songbirds simply slash their sleep time ra...

UW study: Migrating birds offer insight into sleep

...g the day. Cognitive tests showed that, during the migration periods, the birds performed normally -- or even improved their ability to learn -- on little sleep; but during other times, sleep deprivation hurt their performance. The researchers theorize that migrating songbirds have developed the ability to app...

Sequential signals choreograph embryonic tubule formation

... for the differentiation stage but not the initial migration phase." The researchers conclude that HGF directs the complex process of tubule development by dividing it into two distinct phases that are controlled by different molecular signals provided by ERK and MMPs. According to Dr. Mostov, "Proper timing a...

Society for conservation biology conference

...rong Side of the Freeway Major highways limit the migration of large predators and put a major damper on their... rate as high as 12 percent. A study modeling the migration of mammals in 8 large national parks in the United States foresees species losses within the parks a...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument