Tag: "missing" at biology news

Mutation on Y chromosome stops sperm production

...e wanted to see which gene within one of the large missing Y chromosome chunks was important.He first determi... sequence for a region of the Y chromosome that is missing in anumber of infertile males. He found that the region contained only two genes, so he set out to t...

Rats exposed to cell phone microwaves suffer long-term memory loss, according to new study by University of Washington researcher

... most of their time swimming in the area where the missing platform hadbeen located. "They seemed to be scratching their heads, saying 'We thought it was here,'" Lai said. But the irradiated rats behaved more randomly, spending more time swimming in other parts of thepool and showing much less of a tendenc...

Fox Chase Cancer Center's Joseph Testa receives 1999 Irving J. Selikoff Award for Cancer Research

... some basic genetic material, Testa has pinpointed missing segments on seven different chromosomes-the rodlik...hese chromosomes, he has identified genes that are missing or fail to function in mesothelioma cells. His research team is working to identify the affected ge...

Neurosteroids: the missing link?

...al brain compound called a neurosteroid may be the missing link between alcohol and a majorneurotransmitter c...ical & Experimental Research , they have found the missing piece ofthe puzzle. "Neurosteroids are steroid compounds that are called neurosteroids for two reas...

Human stem cell research leads Science's top ten list of the best scientific advances in 1999

...pushing the universe's expansion might fill in the missing matter. This year, new information from a variety of locations showed ripples in the microwave background, the afterglow of the Big Bang, that are exactly the right size to imply a flat universe. Molecules Make a Memory: A series of findings this ...

Mouse embryo hints at how mammalian body forms

...ntiation," says Pedersen. "This could provide the missing clue as to how to control the differentiation of stem cells in vitro." The most likely way to get embryonic stem cells to differentiate into specific cell lines, he surmises, is to do what the embryo does - first make them differentiate into end...

Guilt by association: Scientists nab suspects in prostate cancer

...rfect, diagnosing positive in some healthy men and missing genuine cancer in others. In the December issue of Genome Research, Michael Walker (Incyte Pharmaceuticals and StanfordUniversity), Tod Klinger (Incyte), and colleagues take a step towards better diagnosis and treatmentof prostate cancer with the ide...

Gene mutation results in missing teeth

...cs, directing her students to look for patterns of missing teeth in their patients. One of these students, ...thor Monica Goldenberg, observed a 13-year-old boy missing 14 permanent teeth. Further investigation revealed that the father and two brothers had a similar c...

Pitt team first to illustrate mechanisms of chromosome missegregation in cancer cells

...on, leading to genetic defects such as abnormal or missing chromosomes," said William Saunders, principal investigator on the study, assistant professor of biological sciences and an investigator in the Oral Cancer Center at the University of Pittsburgh. "By witnessing these events, we can now target for st...

UF study shows newborn kittens have shot at survival thanks to immune-boosting treatment

...the serum of normal adult cats to replace the ones missing from newborn kittens, we envision that, using widely available technology, most veterinary clinics would be able to deliver these lifesaving antibodies to at-risk kittens," Levy said. Once their role in the study is complete, the kittens are adopt...

Millennium and Wyeth-Ayerst announce the discovery of key potassium ion channel modulating proteins

... companies believe that these KChIPs are important missing components of native A-type potassium channels which helps explain the difference. The identification of these additional components may allow for the development of new drug screens to identify compounds that modulate A-type potassium channels in a...

Unusual mussels may use whale bones en route to hot sea-floor vents

...ow-water cousins. "Rotting whales may provide the missing link between the huge mussels seen at vents and those you find on your plate in a seafood restaurant," Smith said. Whale carcasses that fall to the ocean floor are a huge source of food for numerous scavengers, including huge sleeper sharks and sli...

Ground-penetrating radar detects hard-to-find hazardous waste

...cement pads that supported the missing storage tanks. It also detected creosote hiding in a couple of unlikely spots -- beneath the tank pads. "At first we thought the pads were there just to support the sto...

Researchers discover retinal stem cells in adult mammals

...lture the cells, make the right tissue type that's missing and then put them back," adds Tropepe, who conducted the research as part of his thesis on characterizing neural stem cells during development of the brain. "We now need to determine if these cells are completely committed to producing their own tiss...

Study points to U.S. as generator of greenhouse gases

...Some past studies suggested that a big part of the missing carbon sink was in the forests and changing land u...r carbon. "On a global basis, we've estimated the missing sink of carbon at about 1.8 gigatons per year," Neilson said. "One earlier study suggested that chan...

Bitter taste receptors identified

...aste buds to the brain. "That meant that we were missing the family of taste receptors that coupled with gustducin," say study co-authors Mueller and Adler, "so we set out to identify those receptors." In their latest studies, the researchers focused on a specific interval of DNA on one human chromosome th...

Community mental health services are lifeline to homeless

...g linked to support services is one of the crucial missing links in constructing a community based system of care for individuals with serious mental illness."(1.) A second published study from the Veterans Affairs Palo Alto Health Care System and Stanford University found more residential substance abuse tr...

X-ray studies shed light on frog deformities

...logist said, two frogs from Minnesota in 1998 were missing a single middle bone from each toe on both feet. ...e 65 malformed frogs the researchers examined were missing all or a portion of their hind legs, but none had multiple toes or limbs. Of the Vermont frogs miss...

First awards made in NIH effort to understand how genes affect people's responses to medicines

...ow a person reacts to a specific medicine could be missing genes, or even extra genes. Through these types of studies, researchers ultimately hope to develop drug dosing into a much more predictive science. "The outcome of pharmacogenetics research has the potential to improve the health of all Americans,...

University of Washington researchers map rice genome

...its totality, Mahairas said. "There are still some missing pieces, like a word or two missing in paragraphs, but you can read and start to understand the entire book of life for rice."...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... 19, 2013 Elsevier, a world-leading provider of ... announced today the publication of the National Osteoporosis ... management of osteoporosis in postmenopausal women and older ... Published in 2009 in Maturitas , the ... update is timely with an additional focus on ...
(Date:6/19/2013)... June 19, 2013 Ultimate Medical Academy ... an 11.5-hour broadcast on WFLA News Channel 8. Since ... more than $84 million for All Children's Hospital in ... themed "30 Years of Miracles," marked the second year ... UMA employees worked the phones during the Telethon, which ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
(Date:6/19/2013)... Recently, SoCal CEO Magazine staff was on hand ... in a series of six workshops where people with and without ... the mosaic tiles in their permanent location under the direction of ... Maxwell. , This mural project began in March of 2013 ... three years ago with the goal of promoting ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Maui'd ... is dedicated to being an effective and cost effective ... needs. They have partnered up with Tom Barefoot’s Tours ... discounts on most of Hawaii’s activities. , They have ... clients can get the lowest prices on their Hawaii ...
Breaking Medicine News(10 mins):Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 2Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5Health News:Arc Creates Huge Mosaic Mural to Highlight the Need for Greater Respect of People with Disabilities 2Health News:Maui'd Forever Pleased to Offer Price Guarantee on Hawaii Activities 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao