Tag: "modeling" at biology news

Taking the pulse of giants: Detecting change and its consequences in western mountain ecosystems

...ver, research focused on monitoring, synthesis and modeling of ecological situations in the Cascades, the Rockies and the Sierra Nevada has increased. Peterson will outline the ways in which this has helped to quantify many of the stress effects on natural resources at regional and sub-continental scales. P...

Fuel cell research center to develop and test new technologies

...brication, fluid dynamics, acoustics and controls, modeling and simulation, power transmission and distributio...nd mixed-conducting electrodes for fuel cells; (2) modeling of molten carbonate and solid oxide fuel cells; (3) extending fuel cell technology for use with elec...

HHMI awards $15 million to scientists outside United States

... techniques to X-ray crystallography, mathematical modeling and epidemiology. The scientists come from Argentina (1); Australia (11); Bangladesh (1); Brazil (4); Canada (4); France (3); Germany (1); Greece (1); Guinea (1); India (1); Israel (1); Mexico (4); Russia (2); South Africa (1); Switzerland (1); Taiw...

European Commission sponsors earthquake risk conference at IIASA

...orld risk management, such as loss mitigation and modeling long-term economic and social effects of earthquakes financial management, such as risk transfer and loss sharing The final day of the conference (July 9) is devoted to presentations on the conference topics by students and young scientists. Thes...

McGill launches Centre for Bioinformatics

...nalysis to biological data. 7. Genetic system modeling and identification: Enhanced computer power makes possible realistic modeling of physiological systems on scales ranging from the molecular to the organism. Modeling plays an in...

Virtual reality tool quantifies physics of a doctor's touch

...'s absolutely critical." The UB research group is modeling on the computer the soft tissue and organs of the human abdomen, using atomic-unit-type modeling that breaks up human tissues into pieces measuring no more than 8mm. The system takes as its raw ma...

UC Davis researchers were key to Clinton's order for marine reserves

... science and policy. Hastings, an authority on the modeling of spatially distributed populations, was co-author of an influential paper that appeared in the journal Science in January 1999. With Botsford, Hastings reported that "no-take zones" in coastal waters could reduce the effects of fishing and better p...

Ney honored for fish research

...r food demand could be determined by bioenergetics modeling coupled with population statistics. Ney formulated these concepts and procedures in a widely cited (1990) monograph, Trophic Economics in Fisheries: Assessment of Supply-Demand Relationships Between Predators and Prey. With his current generation of...

Carnegie Mellon's Carnegie Symposium on Cognition

...ogy, neuropsychology, neurophysiology and computer modeling will address issues raised by a growing body of research dealing with normal development and understanding of the visual world and research that explores what is happening when the brain fails to recognize what it sees. Carl Olson, a senior research...

Shedding light on luminescence: Scientists visualize structure of the photoprotein aequorin

...ical function...with great potential for molecular modeling and designing new sensors for monitoring other ions in a cell," according to Ralph Addison, program director in NSF's biophysics program, which supported this work. Since his discovery of aequorin 38 years ago, Shimomura's life's work has been devot...

No apparent increase in cancer deaths among Three Mile Island residents, report University of Pittsburgh researchers

...hey used standard calculations such as statistical modeling and standard mortality ratios -- direct comparisons of the number of observed deaths with the expected number of deaths in a general population. Mortality indicators examined in the study included all heart disease, all malignancies as well as spec...

UC Irvine researchers discover how airborne sea salt particles may influence air pollution levels

...sea salt chlorine creation into a complex computer modeling program that analyzes and predicts the air quality of the South Coast Air Basin of California--a highly populated coastal area that records some of the highest levels of air pollution in the United States--to see its impact on levels of ozone and oth...

Renowned author, scientist and professor, John L. Casti, returns to IIASA

...ill apply his expertise in developing mathematical modeling to three research objectives: charting topography of Internet usage, modeling risks associated with the world's natural catastrophes, and developing mathematical and conceptual t...

New NASA web site features women's contributions to NASA's Microgravity Research Program

... She started her career with pioneering studies in modeling metals and exploring the best way to conduct a variety of experiments at the same time inside space-based laboratories. "When I was 15 years old, I witnessed John Glenn's first launch into space from my high school yard in Cocoa Beach, Fla., and I ...

Light receptor may be key in how animals use Earth's magnetic field

...ournal that chemical experiments and computational modeling indicate that cryptochrome may be the site of a neurochemical reaction that lets birds, for example, process visual clues from the magnetic field and stay on course. "Animals as diverse as migratory birds, salamanders, salmon, or hamsters use the geo...

Genome scientists muster computer software tools for handling the flood of raw data from the Human Genome Project and related efforts

...idely used statistical method called hidden Markov modeling to attack this problem. To analyze the rough draft of the human genome sequence, Haussler is working closely with researchers at the Massachusetts Institute of Technology's Whitehead Institute. The Whitehead Institute is one of five major sequenci...

Scientist find clues to different warming rates

...nce. The results followextensive data analysis and modeling studies by the 13 scientists.The team includes sec...nd difference, say the authors. In a comprehensive modeling study,they found that the loss of stratospheric ozone and, to a lesserextent, the influx of Mt. Pina...

UNC-CH scientists create world's smallest pieces of ice

...spent hundreds of millions of dollars on molecular modeling simulations," he said. "They are trying to use modeling to aid in the development of new and interesting chemical systems, including new drugs. An important...

NASA'S Earth Science highlights for the 80th Annual AMS Meeting

...tions: Effects on Ozone and Other Trace Gases - A modeling study yields insights on how CO2 and other atmosph...Resolution Stretched Grid GCM - A new approach to modeling regional impacts of climate change produces accurate simulations of the 1993 U.S. floods and 1988 dr...

U-M Medical School receives $4 million for new bioinformatics program

...t to help shape the future directions of concepts, modeling and analysis in bioinformatics and biocomplexity. We also want to empower our scientists to use cutting-edge techniques for current applications in genomics, proteomics, public health genetics and microbial pathogenesis." Funded by the U-M H...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument