Tag: "modify" at biology news

Transgenic animals produced using cultured sperm

...erapeutic options." Past efforts to genetically modify sperm cells in animals prior to fertilization have been stymied by the failure of these cells to mature under in vitro growth conditions. Drawing upon the cell culture expertise of Noriyoshi Sakai, Ph.D., and Kayoko Kurita, of Fukui Prefectural Unive...

Pew report finds GM insects may offer benefits, but clear regulatory oversight is lacking

... Scientists are currently working to genetically modify insects to address important economic and human health concerns. If successful, GM insects could dramatically improve public health and enhance agricultural production. Examples include: Mosquitoes incapable of transmitting malaria, which is...

Carnegie Mellon enhances Quantum Dot Corp. technology for long-term, live-animal imaging

... to molecular dimensions." Scientists also could modify the surface of these long-lived quantum dots by at... to cells other than phagocytes. They also hope to modify quantum dots using biological molecules that could create in situ biosensors to report the presence ...

Transgenic mosquitoes are less fertile than their counterparts in nature

... who leads a major research program to genetically modify mosquitoes to combat mosquito-borne disease, was not surprised that there was a fitness cost associated with transgenesis, but was surprised with the magnitude of it. "Once we determine the genetic basis of these fitness costs it should be possible t...

New device can help defend against novel biological agents

...aper that provides detailed instructions on how to modify the Cytosensor and multipotentiostat to make a four-channel microphysiometer has been accepted for publication by Humana Press and is scheduled to appear later in the year....

New roles for protein modifications in cell migration

...hough Golgi NDPases such as MIG-23 can conceivably modify a number of other secreted proteins, the Nishiwaki study indicates that the effects of the NDPase dysfunction are especially prominent in the abnormal glycosylation and function of an ADAM family protease, suggesting that glycosylation may play a mor...

Symbiotic fungi promote invasion into diverse plant communities (Rudgers et al.)

...ay investigated whether these endophytic fungi can modify how diverse communities resist invasion. Their model predicts that endophyte-infection of a grass invader will weaken the ability of diverse communities to resist invasion and reduce the correlation between diversity and community productivity. Their...

Scientists discover how brain draws and re-draws picture of world

...ate a model of the world around us, and how errors modify that model and change subsequent movements," says Reza Shadmehr, Ph.D., associate professor of biomedical engineering at The Johns Hopkins University School of Medicine. "We don't just know how to control objects around us, we have to learn how." T...

Genes control severity of heart failure, study finds

...ed multiple stretches of DNA containing genes that modify the heart's pumping ability and survival with the ...e Duke team. "Our goal is to find novel genes that modify human heart failure by letting the mouse point us in the right direction," said Duke cardiologist Ho...

Emory scientists use enzymes to enhance regeneration of damaged peripheral nerves in mice

...s to regenerate, the Emory scientists attempted to modify this inhibitory environment following peripheral nerve injury in mice. They treated the peripheral portion of severed nerves with each of three enzymes that degrade specific types of proteoglycans. During the first two weeks after the injury, axon...

Salk news: Gene chips and crop yield

...hnology may lead to the development of new ways to modify plants to grow faster, produce more food and resist disease. The study, which appears in the Oct. 31 issue of Science, led by Joe Ecker, Salk professor of plant biology, and Athanasios Theologis, adjunct professor at UC Berkeley and senior scientist ...

US develops lethal new viruses

...sts might be more tempted to use the same trick to modify a pox virus that infects humans. Such a disease, like anthrax, would infect only those directly exposed to it. It would not spread around the world and rebound on the attackers. But there is no guarantee that other pox viruses modified in a similar w...

Research finds tumor preventive qualities, damage reversal, in green tea

... synthesis of cis racemic EGCG that allows them to modify the A-, B- and D-rings of EGCG independently of each other. Using this method, they created several different analogs (a chemical compound structurally similar, but different in composition). SR 13196, an analog modified in the B- and D-rings, disp...

UB researchers show first evidence of pharmacogenomic differences in patients' responses to MS drug

...t 'signature' quickly and eventually to be able to modify treatment plans rationally," said Frederick Munschauer, M.D., professor and chair of the Department of Neurology in the UB School of Medicine and Biomedical Sciences and chief of The Jacobs Neurological Institute. The effects of IFN-beta-1a at the g...

LabNotes -- Research highlights from Pacific Northwest National Laboratory

... mineralization process within a few hours, but to modify it in ways that may prove useful. Instead of a solid rock-like copy, they have produced an exact replica with pores and channels. This process creates a "positive" replica of the living tissue in just a matter of hours. The microstructure provides en...

Lifestyle changes clinically effective

...ute, and lead author of the study. "Women need to modify their diets to include more fruits and vegetables to help prevent the disease," she said....

Exercise and healthy weight delay cancer even among women with highest genetic risk

...uch as increased exercise and weight control could modify the impact of genetic risk has very intriguing imp...ld continue to study how environmental factors can modify powerful genetic predispositions toward cancer. BACKGROUND ON THE BRCA MUTATIONS AND CANCER Women...

Landmark study offers new information about breast cancer genes

...cancer today to consider changing behavior to help modify their risks of developing breast cancer," she said. The field of genetic counseling, which now extends around the world, was born at Sarah Lawrence College in 1969 with the establishment of the first graduate program to train professionals in both th...

Genetic differences in termite castes may lead to better control

...d their reproductive characteristics. "If we could modify proteins in termites to change workers into helpless soldiers, then we could make 75 percent of the colony soldiers," he said. "That would be pretty lethal to the termites but have minimal environmental impact." Since the alates and the soldiers can'...

Proteins enable HIV to override cell's defenses

... agent, Vif interacts with a series of proteins to modify (polyubiquitination) and degrade APOBEC3G. Xiao-Fang Yu, MD, DSc, an associate professor with the School's Department of Molecular Microbiology and Immunology, and his colleagues have identified these proteins as Cullin5, Elongins B and C and Rbx1. T...

1 2 3 4 5 6 7 8 9 10

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement