Tag: "motor" at biology news

Molecular motor implicated in tissue remodeling

...and other tissues turns out to be a molecule-sized motor that extracts its fuel from the road it runs on, a...nergy into motion. "This is the only extracellular motor known," says Elson, Ph.D., coauthor and professor of biochemistry and molecular biophysics. The res...

Knock knock knocking on rhythm's neural doors

...es. Rhythmic activity created activity only in the motor areas of the opposite brain hemisphere and in the ...uding "planning areas" not directly connected with motor execution. The difference held up even when careful controls made sure that the amount of actual act...

Economy of movement

...f doing these things. However, scientists studying motor control have been hard pressed to figure out exact...se not only in explaining the marketplace but also motor control, Krding and colleagues have added a new tool to biologists' repertoire. Though their approac...

Human chromosome 5 final sequence analysis released to public

...d known that deletions in the gene for survival of motor neurons, (SMN) caused the disease, but people with the same deletion can have much more or less severe forms of the disease. It turns out that the region contains many duplications and other rearrangements and varies considerably between people. Schm...

Protein is key to fatal disorder and normal cell function

...tinct. All NCL disorders cause progressive loss of motor skills, mental retardation, loss of speech, blindn...en the ages of five and eight years, their vision, motor and cognitive skills begin to deteriorate, with uncontrolled seizures and massive cell loss in the b...

Extreme stretch-growth of axons

...es of days, aided by a precise computer-controlled motor system. "By rapid and continuous stretching, we end up with huge bundles of axons that are visible to the eye," says Smith. The axons started at an invisible 100 microns and have been stretched to 10 centimeters in less than two weeks. Smith and coll...

Imitative parrots just might tell you it's all in the tongue

...esearch. "The basic idea here, we believe, is that motor control oftongue movements is an important part of communication, just as it is inhumans." It's known that to produce sound, a parrot uses its syrinx, a voice boxorgan nestled between the trachea and lungs. The lingering question hasbeen: What happen...

Convulsions in worms mimic epileptic seizures

...c acid (GABA). By preventing GABA from inhibiting motor neurons, PTZ causes neuronal overexcitability, res...e-up. The LIS1 protein interacts with a molecular motor protein called dynein, which helps transport the neurotransmitter vesicles within cells. In further ...

Molecular motor myosin VI moves 'hand over hand,' researchers say

... myosin V and kinesin. "Now that a third molecular motor has been found to move in the same hand-over-hand ...mistry. Myosin VI is a reverse-direction molecular motor that moves materials to various locations within a living cell. Like the related protein myosin V, ...

APS awards more than $140,000 to minority students of physiology

... focused on the function of Myosin 5c, a molecular motor protein that is abundantly found in glandular tissues and is hypothesized to facilitate the process of secretion. His research may help to determine the molecular mechanisms that regulate secretion in various tissues, such as the pancreas, mammary g...

Genetically-engineered 'marathon mouse' keeps on running

...ber content, but also improves circulation and the motor neuron innervation into those muscles. Training also reengineers the heart to allow it to pump a greater volume of blood. "So, it was not at all obvious that changing one gene in muscle would lead to coordinated changes throughout the body, from the...

New understanding of the machinery of flinching

...ugs. Their studies concentrated on a region of the motor cortex they have dubbed the polysensory zone, whic...nsory zone controls the natural behavioral flinch; motor cortex is usually not thought to control full, natural movements. To do this, they investigated how ...

Stem cell research targets cerebral palsy

...t. He'll also look at the bottom line: whether the motor skills of the animal model are improved following ...mut, from barely detectable to devastating loss of motor control. The causes are diverse as well, including everything from oxygen deprivation during birth t...

Infant rats eagerly accept high concentrations of alcohol upon first exposure

...re at birth than are humans," said Spear, "but the motor capability of the rat develops more rapidly thereafter in the infant rat than the infant human. In terms of brain development, our rats might correspond to humans between a few days and six months after birth, but in terms of sensorimotor ability, t...

RNA could form building blocks for nanomachines

...ecule for years. It formed the "pistons" of a tiny motor his lab created several years ago, and members of the team collaborated previously to build dimers and trimers - molecules formed from two and three RNA strands, respectively. Guo said the methods the team used in the past made their recent, more com...

Rutgers-Newark biologist links presence of protein to spread of cancerous cells

...or activate other proteins, including myosin II, a motor protein instrumental in taking energy and converting it to movement in the human body. The researchers' findings identified a link between cell division and a cell's ability to remain associated with its parent tissue. According to Dr. Bonder, resear...

Spiders or scapegoats

...s of car travel even though more deaths occur from motor vehicle accidents each year than from spider bites...ime they travel in a car. In 2001, there were 1183 motor vehicle deaths involving drivers or passengers in Australia, but no deaths from spider bites." Vari...

Scientists pinpoint molecules that generate synapses

...s in the brain's cerebellum, a critical center for motor control; it's unclear whether it also serves as a signal to foster synapse growth between neurons in other areas. Two other members of the FGF family, FGF7 and FGF10, are very similar in structure, and may play similar roles in other areas of the ner...

Yale scientists visualize details of how hepatitis C unwinds RNA

...ed as a model for studying unwinding activities of motor proteins. Their findings are particularly importa...t helps to bring RNA helicases to the forefront of motor research. "By visualizing one of the key steps in how hepatitis C makes copies of itself, Dr. Pyle u...

Molecular motor shuttles key protein in response to light

...Lee, Ph.D., had a hunch that myosin -- a molecular motor -- might play a role in transporting arrestin. Stu...lear, the researchers showed that arrestin and the motor don't bind to each other directly. Instead, they are "glued" together by a sticky fat, called phosph...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... DiscountFurnaceFilter.com, the number one solution for homeowner’s ... Compressor Saver kit at an exceptional price. The 5-2-1 Compressor ... air conditioning unit during start up, saving wear and tear ... unit burn out. , The 5-2-1 Compressor Saver ... uses less power to start and drastically reduces the rush ...
(Date:6/19/2013)... 19, 2013 Kansas City will host its first ... Street Day . A section of Main Street in the midtown ... afternoon of the event. The Main Street Corridor Development ... will help Kansas City join the ranks of dozens of cities ... tool to foster community vibrancy and active lifestyles. , “Ciclovia is ...
(Date:6/19/2013)... June 19, 2013 In 2011, the ... EUR 710 million. Generic drugs form the largest sector, ... value. The pharmaceutical industry is a significant contributor to ... the country’s GDP. Approximately 50% of the total domestic ... pharmaceutical industry. Hemofarm, Galenika and Zdravlje Actavis are key ...
(Date:6/19/2013)... Elsevier, a world-leading provider of scientific, technical ... the publication of the National Osteoporosis Guideline Group ... osteoporosis in postmenopausal women and older men in ... 2009 in Maturitas , the original guidelines ... timely with an additional focus on the management ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
Breaking Medicine News(10 mins):Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 2Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 3Health News:Serbian Pharmaceutical Market Scrutinized by CUBE in Topical Report Now Available at MarketPublishers.com 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5
Other Tags
nevadaclocksfitnesskeepsprimevalantiangiogenichorizonsubmitapheresisrenownedareprioritiescortexgambiaopposeshivmaputs