Tag: "nanoparticles" at biology news

Device detects, traps and deactivates airborne viruses and bacteria

...zes. On the walls of the device, Biswas has coated nanoparticles that catalyze the oxidation. These nanoparticles are "smart" objects that are turned "on" and "off" by irradiation. "This smart catalyst is unique," ...

Nanoparticle probes are destined for major new role in medical diagnostics and drug delivery

...anomedicine field, and has developed semiconductor nanoparticles called quantum dots, which can be bound to particu...ays. "Scientists have begun to develop functional nanoparticles that are linked to biological molecules such as peptides, proteins and DNA." By virtue of their mi...

Biodegradable particles mimic white blood cells, target inflamed tissue, new study finds

...t will test different polymers as well as smaller nanoparticles -- that could degrade even faster in the body and offer different drug delivery options, he said. Quick degradation also could help avoid uptake by organs not intended to receive the particles, he said, a possible negative side effect of the process....

New method could aid in prostate and breast cancer diagnosis

...eloped an ultra-sensitive technology based on gold nanoparticles and DNA that can detect prostate specific antigen (PSA) when present at extremely low levels in a blood sample. This promising new protein-detection method could be used to monitor prostate cancer patients following surgery and to detect the early si...

Pinpointing viruses in body scans

AN INJECTION of magnetic nanoparticles into your bloodstream could reveal precisely where...he particles are ready for use. In lab tests, the nanoparticles have been added to samples of body fluids; in patients, they would simply be injected. If live virus...

UCF brain cell research spawns hope for longer life

...alinski said. "The cells exposed to the engineered nanoparticles lived three to four times longer." To confirm the ...t recently, the Rzigalinski lab has found that the nanoparticles have potent anti-inflammatory properties. The investigators plan to explore the possibility of crea...

Tufts researchers find new cost-effective catalyst for hydrogen production for fuel cells

... time studying the properties of gold and platinum nanoparticles that are used to catalyze the reaction of carbon m...xide catalyst carrying the gold or platinum, metal nanoparticles are not important. Only a tiny amount of the precious metal in non metallic form is needed to create...

Hebrew University researchers develop method to improve neutraceutical absorption

...lsion. Nanodroplets of the microemulsion bind with nanoparticles of the nutraceutical or cosmetoceutical. The nanodroplets carry the nutraceutical nanoparticals through membranes and release them upon reaching their destination. The microemulsions are highly dilutable and also can be turned into powders. As a resu...

Gold nanoparticles and catalytic DNA produce colormetric lead sensor

... variety of environmental contaminants. Using gold nanoparticles laced with DNA, Illinois chemistry professor Yi Lu...duate student Juewen Liu are able to hybridize the nanoparticles into aggregate clusters that have a characteristic blue color. In the presence of a specific metal i...

Integration of nanotechnology with biology and medicine will result in major medical advances

...ready, scientists have begun to develop functional nanoparticles that are linked to biological molecules such as pe... and smaller. Because of their compact structure, nanoparticles emit light and can act as a fluorescent tag. This makes them highly suitable as contrast agents for...

Gold 'nanoplugs' wire up enzymes

...ational Laboratory, have devised a way to use gold nanoparticles as tiny electrical wires to plug enzymes into elec...ven biologist Jim Hainfeld, who developed the gold nanoparticles and the means of attaching them to other molecules, is to measure the current as an indicator of the...

Nanotech decoys for viruses

...ering human cells. The group has already made gold nanoparticles coated with a non-patterned membrane. These particles are not toxic to cells and were able to bind gp120, Gervay Hague said. The work is funded by a $1.2 million Nanoscale Interdisciplinary Research Team grant from the National Science Foundation....

Nanoparticles could aid biohazard detection, computer industry

... The scientists also have learned how to use these nanoparticles as a bridge to connect the chips with organic mole...ve to be a gold mine. "All you need to do to form nanoparticles is dip the semiconductor into the solution and wait," Porter said. "Though you begin with a solution...

Beyond patches and pills: the remarkable future of drug delivery

...ompound to deal with the chemical imbalance. These nanoparticles are biodegradable, and they will self-destruct after two or three days. Ultra-easy ultrasound -- Remember "Star Trek," when the ship's doctor, Bones, would zap people with his painless gadget to give them their medicine? "We've actually worked out ...

Non-invasive imaging technique detects plaques beginning to form in vessels

...t in rapidly growing capillaries. In so doing, the nanoparticles mainly latched onto cells that contain avb3. "You can load these nanoparticles with whatever you want, like a Mr. Potato Head," Wickline explains. "The targeting agent allows us t...

Tailor-made cancer drugs: Wave of the future?

...r's RNA-docking molecules to Wooley's new breed of nanoparticles for on-the-mark, stay-put delivery of diagnostic and disease-fighting agents....

New nanoparticle coating mimics dolphin skin

... University professor of chemistry, hope to employ nanoparticles that will take advantage of naturally occurring ch...tions on or turn them off," said Wooley. "With the nanoparticles we want to turn them on; with the antifouling coatings materials we want to turn them off." Fouling...

Biomedical scientist testing nanoparticles as early cancer detection agent

...edical scientist Shuming Nie is testing the use of nanoparticles called quantum dots to dramatically improve clinic...proteins," Nie said. He plans to use bioconjugated nanoparticles for early identification, quantification, and localization of gene sequences, proteins, infectious o...

Scientists use alfalfa plants to harvest nanoparticles of gold

... gold from the medium and stores it in the form of nanoparticles - specks of gold less than a billionth of a meter ...try is very interested in processes that make gold nanoparticles for nano-scale electronic and optical devices. Gold factories Some processes for making high concent...

Scientists at the Scripps Research Institute design gene-tipped tumor regressor 'smartbombs'

...ators first report how they successfully delivered nanoparticles with "reporter" genessuch as those encoding for lu...ic demonstrations of the specific targeting of the nanoparticles to tumors. (The tumors glowed green under a microscope). Cheresh and his colleagues then combined t...

1 2 3

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition