Tag: "native" at biology news

Grasslands, deserts, mountains and fire

...e Desert scrub communities has led to concern that native plant communities will be converted to nonnative a...dioxide mean more plants in the mojave? Should the native plants care? The amount of carbon dioxide in Earth's atmosphere is expected to double before the e...

Giant jellies invade Gulf of Mexico threatening shrimp fishery

...n swimmers because their sting is mild compared to native jellyfish like the Sea Nettle. However, the jellies' threat to the area's ecosystems is yet to be determined. Similar alien jellyfish have caused major disruptions in marine fisheries in Europe - in some cases driving out other marine life. "One ...

Cows and conservation: a round-up of speakers to discuss new ideas on ranching

...te habitats in a way that proves favorable to some native species. Budd will examine how a combination of ...ploys a progressive approach to using domestic and native animals for economic return while maintaining land health and biological diversity. The ranch is hom...

High-resolution image illuminates catalytic engine of the ribosome

...can see in this structure that some aspects of the native ribosome reflect some aspects of those RNA molecules produced through in vitro evolution. So, the expectation that a small RNA molecule could have evolved to catalyze peptide bond synthesis is not a far stretch. "However, that peptide-making RNA m...

Soybean pest native to China detected in U.S. for first time

...ultural and Life Sciences. "The soybean aphid is a native of China and hasn't been reported from the United ...e the soybean plant itself, the soybean aphid is a native of China. In China the aphid only attacks soybean plants and buckthorn, a woody shrub. "Since the so...

Bullfrogs invading Canada's west coast

...erenade is signalling big trouble for the Island's native frog species and aquatic ecosystems in general. ...vidence is mounting that bullfrogs are supplanting native frog species. "Once bullfrogs get established they pretty much clean out the competition," notes Gov...

Researchers at four universities develop most comprehensive CD to identify North American trees

...woods) and gymnosperms (softwoods) and covers both native and ornamental woody plants found across North Ame...single largest collection of color photographs for native woody plants found in North America," said John R. Seiler, forestry professor at Virginia Tech. The ...

Wolves in Yellowstone may aid aspen recovery

... partly due to the absence of wolves. The loss of native aspen groves in Yellowstone and other areas of the Rocky Mountains is reaching crisis proportions, experts say, having declined as much as 50-90 percent in certain areas. Now, scientists have outlined in more detail the magnitude of the aspen declin...

An "alarming" discovery for ruffe

...ed from the bottom of the harbor. Their impact on native aquatic species remains unclear but is under investigation. Currently, ruffe have spread along Lake Superior's south shore to the Fire Steel River, east of Ontonagan, MI; to several harbors along the north shore to Thunder Bay, Ontario; and to Alpen...

Researcher proves fetuses hears at 30 weeks

...t it shapes the infant to prefer and recognize its native language. But we still don't know if your child will be brighter, for example, if you play music to it in utero, despite the notions disseminated in the popular media. Today many entrepreneurs talk about "fetal universities," and sell devices that...

Bio-X grant recipient explores link between molecular chaperones and serious diseases

...onized. New information on how proteins find their native shapes with the help of chaperones will be obtained, which may lead to improved therapies for diseases in which this process has gone awry.`` Protein factories Life would not be possible without proteins. Some fight disease, while others re...

Ion microscopy pinpoints drugs inside cancer cells

...t the subcellular location of labeled molecules is native to the cell. The form of ion microscopy described ...tion of cells with cryogenic methods preserves the native chemical and structural makeup of the cells for ion microscopy analysis." The ion microscopy group a...

International students gain fat, weight from American diet

...s well. While urbanites may have greater access to native foods in specialty markets, they also face more fast-food temptations. "My friends who are studying in Columbus, Ohio, and New York City also have gained weight, because fast food is still a cheap choice for them," said Chen. The findings of this l...

ORNL instrument could spell doom for Asian beetles

...oratory (ORNL). Larvae from the beetles, which are native to China and Korea, are inadvertently imported into the United States nestled inside the wood of shipping crates containing a host of products. Within days of their arrival, beetles are out boring into trees, where they lay eggs. The larvae start eat...

Singing silently during sleep helps birds learn songs

...lls of four zebra finches, a well-studied songbird native to Australia that weighs only about half an ounce. The male zebra finch works hard to attract the female with his stereotyped song, and the brain structures that control singing are highly specialized for this behavior. The researchers compared t...

Worldwide transfer of microorganism facilitated by ballast water

...ous aquatic invader of the U.S. in recent years. A native of the Caspian Sea, it was most likely released by...80s. Its spread has been astounding. Overwhelming native species, it has caused extensive environmental and economic damage throughout the Great Lakes and ha...

Hunted deer make up for losses of bucks, UF research shows

..., a University of Florida professor says America's native white-tailed deer have some unique ways to compensate for hunting. Hunters most often pursue bucks, both for trophy value and because shooting does in many states is illegal or highly restricted. That might seem to threaten deer populations becau...

Bilbies invade central Australia

...uge section of desert country and re-establish the native animals that vanished from it long ago. The Arid Z... Easter Bilbies to draw attention to this charming native marsupial, and the extent to which it has declined through competition with feral animals. Removing ...

Turning blood into brain: new studies suggest bone marrow stem cells can develop into neurons in living animals

...planted cells as a marker to distinguish them from native cells. At different time intervals, the researche...o their environment and began to function like the native ones. These studies suggest that bone marrow, which is an easily available source of cells, could...

Scientists fight to bring the American chestnut tree back to life

...hybrids out into these plots, they will cross with native trees. The first generation offspring will be intermediate in resistance, but in subsequent generations trees with full resistance will be produced." Valued for their beauty as much as their wood and nuts, the hope is that the majestic chestnut will ...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan