Tag: "necessary" at biology news

Immerge reports PERVs most infectious to human cells not part of germ-line DNA of mini-swine

...engthy breeding programs, which were thought to be necessary to remove germ-line viruses, might no longer be required. "Our identification that human-tropic PERV is acquired somewhere during life, rather than something the pig is born with is a major step forward. It allows us to develop measures that will ...

European researchers launch 10 million euro collaborative technology project

...ities. "We already have all the single components necessary to solve molecular structures," says Victor Lamzin, grant coordinator at EMBL-Hamburg. "We have synchrotrons, we can grow protein crystals, we have the software components and we can obtain structures. But the tools we use were not originally design...

Copper may play role in 'starving' cancer to standstill

...to create blood vessels, and if blood vessels were necessary for tumor growth, what would happen if copper were regulated? "Studies looked at inoperable cancer -- cancer that couldn't be touched as in deep in the brain," Harris said. "There was some impact, but there also was fear that perhaps such treatment ...

Penguin bones from 'land of fire' rewrite bird's evolution

... comprehensive study of the penguin family tree is necessary before the full story of early penguins in the Land of Fire can be told. But she's confident that the discovery will help clarify the timing and pattern of penguin diversification. "This is the first vertebrate from that distant epoch ever found in T...

Making of mouse marks move toward 'mitochondrial medicine'

...with that from another in a gene-swapping exercise necessary if doctors are to understand several currently untreatable human diseases. "What we call mitochondrial medicine how specific mitochondrial mutations and deficiencies lead to disease didn't even exist 15 years ago. Now the field is in its infancy. ...

Researchers determine reason for deadly spread of 1918 influenza

... 1918 pandemic. Such scientific detective work was necessary because the virus had apparently gone extinct and had not been preserved in specimens from that era. Using this sequence data, Wiley, Skehel, and their colleagues synthesized the gene for the H1 hemagglutinin and used it to produce the protein itself...

A joint effort against the Oriental boil

... the causative agents, hosts, vectors and patients necessary for conducting the research are only available locally. At the beginning of their work, the scientists first had to determine exact numbers for the distribution of the causative agents and the affected animal and human hosts. Within the scope of the ...

The Rosetta space probe's long trek to Comet 67P/Churyumov-Gerasimenko

...eployed and turned towards the Sun to build up the necessary power reserves. Its various systems and experiments will be gradually brought into operation and tested. Just three months into the mission the first active phase will be over, followed by final testing of the experiments in October 2004. Rosetta wil...

Inherent mistrust of research institutions limits minority representation

...search institutions to the minority communities is necessary to attract significant numbers to participate in clinical research. Developing a customized outreach plan and enlisting the aid of community leaders and social service agencies to increase awareness can help create suitable contact points for target ...

Microbial biofilm yields community genomes, metabolic clues

...sible the oxygen,carbon dioxide, nitrogen and iron necessary for respirationand metabolism. While researchers are unsure which organisms are responsiblefor creating some key polymers, they found within theLeptospirillum strain-but not in the Ferroplasma strain-thegenes for making cellulose and other proteins ...

Death-defying approach devised by Penn scientists to prevent cell apoptosis

...en. Ironically, the process of reoxygenation - so necessary for full recovery - also generates reactive oxygen species (ROS), molecules that induce apoptosis, or cellular death. Now, researchers at the University of Pennsylvania School of Medicine and the University of Iowa have identified a biochemical strat...

Using a companion crop to control weeds organically

... some means of terminating the inter-seeded rye is necessary for effective management across a range of precipitation levels," Thelen said. "In 76-cm row organic soybean production systems, mechanical cultivation would be an approved practice for terminating rye growth. However, in 19-cm drill-planted systems,...

Rice and M. D. Anderson establish Center for Computational Cancer Research

...important challenge." High-performance software is necessary in cancer research because of the large size of the databases. Cancer is many thousands of different diseases. For malignancy to occur, a number of mistakes must become established in the DNA of the descendants of a single cell. Since these mutations...

Study calls for end to age thresholds for prenatal genetic testing

...er services. A single economic evaluation provides necessary but insufficient information about the appropriate level of service. Good evidence for decisions about effectiveness is growing (eg, the Cochrane Library), but choosing how to allocate resources between options requires additional evidence from well-...

New advance to combat antibiotic-resistant pneumonia and malaria

... grow pneumocystis enzymes in the large quantities necessary to isolate and study the cytochrome bc1 complex. Yeast is an excellent resource that can be manufactured in large quantities and can be easily modified to take on the qualities of more dangerous pathogens. The researchers were able to genetically t...

Jan. 23-26 conference in Oakland, Calif., to discuss aneuploid theory of cancer

...ncer: that a mere four to seven gene mutations are necessary for a cell to turn into a cancer cell. Yet, many scientists find that this theory does not explain what they see in cancer cells, namely, gross changes in the number and arrangement of chromosomes. Duesberg, in a paper published in 2000, reviewed man...

If airbags work well, then Mars landing sites can be chosen more boldly, says UB geologist

...around in the water. "So, since we think that the necessary ingredients for life on earth were water and heat, we are looking for the same things on Mars, and while we definitely have evidence of water there, we still are looking for a source of heat." Gregg hopes that a future landing Mars site will be near...

Researchers develop model to help control West Nile outbreak

...l provides a new analytical method for determining necessary mosquito control levels. "This virus is endemic an... is tell you just what percentage of mosquitoes is necessary to kill to keep the virus below an outbreak. This is a first step towards effective management." The...

Mars on Earth?

...eted in organic materials, the chemical precursors necessary for life. Last year, in the driest part of Chile's Atacama Desert, the research team conducted microbe-hunting experiments similar to Viking's, and no evidence of life was found. The scientists called the finding "highly unusual" in an environment e...

Medical students inadequately prepared for clinical rotations, caring for chronically ill

...ent reported that students were less prepared than necessary in all six competencies upon entering the clerkshi...y. Only 27 percent felt this level of ability was necessary to understand systems of care. Fifty percent said students were less prepared than necessary in e...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument