Tag: "next" at biology news

Scientists discover new intricacies in how ulcer bugs stick to stomach

...from one person to another, they can't predict the next host's blood type, so they maintain a form of babA flexible enough to bind to all the different Lewis b receptors," explains Berg, who is also a professor of genetics and of medicine. "In Amerindian populations in Latin America, though, almost everyo...

Gene defects found in age-related macular degeneration

...ations, they are not detectable." The researchers' next steps will include producing cell cultures and animal models that harbor the mutations identified in the NEJM study. These steps will help researchers determine whether the fibulin proteins do have an altered function that would produce AMD. The d...

Research reveals role of gene in infertility

...l complex--a thick piece of the chromosome sitting next to another thick piece with a thin central element joining the two. This synaptonemal complex should form during meiosis for the entire set of chromosomes in normal plant cells, but Ma found that it does not form in the reproductive cells of the mut...

Songbirds escaped from Australasia, conquered rest of world

...onesian island of Lombok but very few on Bali, the next island to the west," said Barker. "And, sure enough, the line separating the Asian plate from the Australasian plate runs between Bali and Lombok." ...

LSU vet school professor uses gene therapy to destroy cancerous tumors

...l the tumor is eradicated. Cytokine treatment, the next step in the therapy, involves the induction of "immuno-memory" into the patient. This allows the body to "remember" the particular type of cancer that it had and effectively vaccinates the patient against it. "The treatment kills the tumor and help...

New textbook introduces students to the foundations, applications of nanotechnology

...id. The book was released in early July 2004. "The next challenge is the rapid evolution of the field," Heflin said. "In three years, the book will have to be substantially updated to include the latest advances."...

New drug shows promise against Gleevec resistance in mice

...veloped as a "molecularly targeted" inhibitor, the next generations of Gleevec, of which is BMS-354825 is one, will be refined and improved by structural biology studies that show how the drugs "fit" with their target, and how mutations alter the shape of that target. The all-important drug targ...

Protective mechanism exploited by tumors may provide new cancer treatment

...thing that causes harm to patients. So that is our next task: to test it in animal models to see if it's a safe and appropriate thing to give patients," Dr. Munn says....

When male fish hum, females swim in, thanks to hormones, adaptable hearing

... us insight into how this plasticity operates. The next step is to locate where this plasticity occurs. There are four possibilities, at the sensory hair cells in the ear, in the auditory nerve, in the brain or in all three at the same time." The jump is a big one, but Sisneros said the research eventua...

Dog genome assembled

...d plan to publish results of their analysis in the next several months. The dog genome is similar in size to the genomes of humans and other mammals, containing approximately 2.5 billion DNA base pairs. Due to a long history of selective breeding, many types of dogs are prone to genetic diseases that are...

New model explains why costly insect 'outbreaks' hard to predict

...ed, small mammals like voles and lemmings could be next in line. "Some of the ideas in our model are probably translatable, given that there are these two dynamics -- predation and pathogens -- for many species that have outbreaks," said Dwyer. ...

Argonne scientists determine structure of staph, anthrax enzyme

...w that the structure is known, Joachimiak said the next step is to mimic the signal sequence, or peptide, in the protein with a drug that blocks the enzyme. "We would like to design a drug that will look like the peptide, but will not be the peptide," he said. "Something else that will bind to the same si...

Comparing primate genomes offers insight into human evolution

...sitory of sequenced genomes, it is likely that our next of kin will again hold promising clues to our own identity. Comparing primate genomes is an approach that can help scientists understand the genetic basis of the physical and biochemical traits that distinguish primate species. James Sikela and colle...

Institute for OneWorld Health receives Gates Foundation grant

...ding research and development activities, over the next 12 months, OneWorld Health will provide to Sanaria regulatory consulting and expertise on the project. This may include guidance in developing the quality assurance and quality control program for monitoring the manufacturing process, as well as pla...

New 20-year study links COPD and asthma

...nchitis and emphysema at initial survey. Over the next 20 years, 12 periodic follow-up surveys and lung function tests were administered. Study results showed that patients with active asthma were 10 times more likely to acquire symptoms of chronic bronchitis, 17 times more likely to receive a diagnosis...

New study in moths shows insects not entirely ruled by instinct

...ave documented these nervous system changes, their next step is to take a deeper look into the neural networks and figure out what causes them to respond to changes. "This study is a first pass at trying to understand how sensory neural networks code information, and how that coding process changes as an ...

Secret behind hard exoskeletons, spreading wings revealed

...lleagues then wanted to take their findings to the next level and determine that the genetic sequence they had found was in fact coding for bursicon. "Based on previous research, we knew that certain nerve cells produce bursicon and that the very same cells produce another protein, crustacean cardioactive...

LSU researcher discovers new bird

...d as he returned to lead tours in the area for the next few years, but it didn't reappear. "After three years, I was starting to doubt my sanity," said Lane. Then, last year, the pair finally saw it again, and this time, the rest of the group saw it as well. They were also able to make a length...

$1.86 billion boost for UK science and innovation

... in the UK to rise to 2.5 per cent of GDP over the next decade, and provides annual real growth in public science funding of 5.8 per cent over the 2004 Spending Review period - with science spending one billion pounds higher in 2007-08 than in 2004-05. The Government's vision is for many more skilled scie...

When sun's too strong, plankton make clouds

...ver summer and a gradual decline over winter. The next step for the researchers will be to see how much the added clouds from plankton actually impact climate. By figuring out how plankton react to light, scientists now have the information they need to use computer models to recreate the impacts of plan...

1 2 3 4 5 6 7 8 9 10

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid