Tag: "nutritional" at biology news

Standing tall: Plains indians enjoyed height, health advantage

... populations, he said, especially nutritional status, as determined by diet... "The Plains Indians had a remarkable record of nutritional and health success, despite the enormous pressures they were under," ...

Scary study: Selenium deficiency causes flu virus to mutate into more dangerous forms

...nt and potentially disturbing because they suggest nutritional deficiencies can promote epidemics in a way not ap...lier work with coxsackievirus, shows that specific nutritional deficiencies can have a profound impact on the genome of RNA viruses. Poor nutritional status may co...

Dietary study finds marijuana users have normal nutritional status, risky lifestyle habits

...y University at Buffalo researchers, paint a mixed nutritional picture. Their study, published in the June issue ...f chronic diseases." The study examined diet and nutritional status of marijuana users and non-users between the ages of 20 and 59 based on NHANES III data colle...

Gene therapy restores feeding behavior to starving mice

...of feeding behavior in mice may offer insight into nutritional problems in Parkinsons disease patients, said Palmiter. Its known that people with Parkinsons have eating difficulties, which have been ascribed to difficulties in manipulating utensils, chewing and swallowing, as well as depression, Palmiter said. O...

Stress, infertility linked in study by Magee-Womens Research Institute

..., such as a tendency toward perfectionism and poor nutritional or lifestyle choices. Many just try to get too much done in a day. Fourteen women took part in the most recent phase of the study. Seven were treated with sessions of cognitive behavior therapy and dietary counseling, while seven were not. All were o...

For peppers, hot quite literally the spice of life, UF research shows

...so, they found a pepper similar in size, shape and nutritional content to capscium annum -- but because of a genetic quirk, the pepper, a variety of Capsicum chacoense, completely lacks capsaicin. The researchers fed this spiceless pepper to packrats, mice and birds in labs. All gobbled it up. When the researche...

Monsanto and researchers celebrate first anniversary of sharing rice genome sequence data

...ariety of discoveries to enhance food security and nutritional needs throughout the developing world," said Robb Fraley, Chief Technology Officer of Monsanto. Monsantos sharing of the rice genome sequence data reflects the New Monsanto Pledge and its commitment to sharing of knowledge and technology with public ...

The true encroacher, human or alligator?

...e result. Scott's group has recently carried out a nutritional study related to farming alligators. His group has explored what diet will allow alligators to grow out to maximum length and produce the most leather and meat. Scott found that Vitamin E and Vitamin B1 (thiamine) had distinct effects on alligators'...

Trial drugs for Huntingtons disease inconclusive in slowing disease

...in Huntingtons disease. Coenzyme Q10 is sold as a nutritional supplement in pharmacies and health food stores. Participants in the randomized, double-blind CARE-HD study were assigned to one of four treatments: 25% received remacemide, 25% received Coenzyme Q10, 25% received the combination of Coenzyme Q10 and ...

New insight into diet and colon cancer

...ts in animal science, food science and technology, nutritional sciences and veterinary anatomy and public health and holder of the William W. Allen Endowed Chair in Nutrition, and Raymond J. Carroll, Distinguished Professor of Statistics, Nutrition and Toxicology, have been working for four years to understand w...

American Chemical Society meets August 26-30 in Chicago

...ss how a person's genetic code can be used to make nutritional decisions that could affect the prevention and con...nority entrepreneurs; Chemistry and the flavor of nutritional beverages including, the risks and benefits of herbal drinks and herbal foods; Recent advances i...

American Chemical Society meeting features cutting-edge research August 26-30 in Chicago

...interventions that fight disease, the chemistry of nutritional beverages, environmental threats to the Great Lakes region and energy needs for the 21st century will be featured at a gathering of worlds largest scientific society in Chicago, August 26-30 CHICAGO More than 6,000 cutting-edge research findings w...

Nitrogen: Too much of a good thing?

...romising food production by gradually changing the nutritional make-up of peoples diets in both affluent and modernizing countries. Tuesday October 16, 2001: Nitrogen Around the World and Its Affects On day two, speakers from the Netherlands, China, and the United States will give conference participants a globa...

Leptin may hold key to better weight loss

..." says Carol Boozer, D.Sc., assistant professor of nutritional medicine in the Institute of Human Nutrition at Columbia, and lead author of the study. Dr. Boozer is also director of the Energy Metabolism Laboratory in the New York Obesity Research Center at St. Luke's-Roosevelt Hospital Center. "This study shows...

Soy protein prevents skin tumors from developing in mice, UC Berkeley researchers find

...red with the control group," said Ben O. de Lumen, nutritional sciences professor in UC Berkeley's College of Natural Resources and principal investigator of the study. De Lumen is a member of UC Berkeley's Health Sciences Initiative, a partnership among biomedical sciences and technology programs geared toward...

Virginia Tech leads global effort to sort out social, economic impacts of agricultural biotechnology

...o add to the value of crops, such as by increasing nutritional value, adding certain vitamins, or in coaxing plants to create substances that can be used in making pharmaceuticals. The study is concentrating on tobacco and rice because those crops are the focus of much biotechnology research. Tobacco is a plant ...

Unique UNC study confirms suspected worldwide epidemic of childhood obesity

...s across countries." Wang completed a doctorate in nutritional epidemiology at UNC last spring and recently joined the University of Illinois at Chicago as assistant professor of human nutrition. A report on his findings appears in the October issue of the International Journal of Epidemiology, which is being pu...

Kansas State University nutrition research finds: Eggs have a lipid that lowers cholesterol absorption

...eating one to two eggs a day. There's more overall nutritional benefit than harm to be gained from eating "nutrient-dense" eggs -- in moderation, he said. Egg contains a higher quality protein than protein found in meat, milk or fish. Furthermore, egg is a significant source of vitamins A and E, and B vitamins, ...

Fred Hutchinson Cancer Research Center, University of Washington join in national effort to study health impact of toxic substances

...include exposure to metals such as methyl mercury, nutritional changes, and physical factors such as hyperthermia (exposure to excessive heat, which can occur if a pregnant woman experiences a high fever). Adverse neurodevelopmental effects of exposures can range from behavioral changes to major birth defects su...

Stanford scientists to probe inner workings of remarkable microbe

.... ``By exposing these organisms to a wide range of nutritional restrictions and environmental stimuli, including toxic chemicals, we will be able to pinpoint which genes turn on and off under different stresses. This will help define the purpose of some genes whose function is currently unknown.`` Asymmetrical ...

1 2 3 4 5 6 7 8 9 10

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement