Tag: "offering" at biology news

New AAAS project links judges to experts in science and engineering

...sociation for the Advancement of Science (AAAS) is offering to help federal judges find well-respected, impartial scientists and engineers to serve as expert witnesses, a step that could help the judiciary understand increasingly complex issues without having to depend on experts whose fees are being paid by ...

Fertility experts urge clinics to consider natural cycle IVF instead of routine use of ovarian stimulants

... offered at 23% of the costs of stimulated cycles, offering savings of at least between 4,769 and 9,587 per pregnancy. Dr Nargund said: "Ovarian stimulation leads to up to 5% of women developing ovarian hyperstimulation syndrome, which is a life-threatening condition that affects nearly 1,500 women annually i...

Tipsheet: Journals of the American Society for Microbiology

...gh some properties of garlic oil are identified as offering greater therapeutic potential," say the researchers. "Further exploration of the potential of garlic powder and garlic oil in enteric disease control appears warranted." (Z.M. Ross, E.A O'Gara, D.J. Hill, H.V. Sleightholme and D.J. Maslin. 2001. ...

Avocados contain potent liver protectants

...zuoka University in Shizuoka, Japan. "Besides offering taste and nutrition, avocados seem to improve liver health," says Kawagishi. "People should eat more of them." Five compounds appear to be active in reducing liver damage. Each was tested in rats with chemically induced liver injuries. The injur...

First-ever complete plant genome sequence is announced

... as the plant counterpart of the laboratory mouse, offering clues to how all sorts of living organisms behave genetically, with potentially widespread applications for agriculture, medicine and energy. This achievement, by a consortium of scientists called the Arabidopsis Genome Initiative (AGI), becom...

Finding could lead to new approach for treating severe heart disease

...amaged heart tissue, without causing side effects, offering hope for a treatment strategy for coronary heart disease that until now has met with setbacks. The finding is reported in the current issue of Proceedings of the National Academy of Science. VEGF, or vascular endothelial growth factor, induces the gr...

UCSF-led study offers insight into cancer development, resistance to therapy: finding focuses on Ras oncogene

...ses the function of the p53 tumor-suppressor gene, offering an important insight into the development of some cancers, and an explanation for why some cancers are resistant to radiation therapy. The finding is published in the current issue of Cell. The Ras gene is part of a molecular pathway that transmits m...

Advances in animal medicine increase quality of life for older pets

...etter served by an exam every six months." "We are offering the client more options instead of dictating to them," Fortney said. "Clients today are better informed and more involved in their pet's health care. Together, clients and veterinarians can improve the quality of life for aging pets. The owner is a c...

Winners of the DFG Bioinformatics Initiative

...tentials in order to boost their attractiveness by offering forward-looking courses, to provide qualified training for urgently required new blood for academic research and industry and, in doing so, to improve Germany as a science location. On the basis of recommendations drawn up by an international team of...

UCSF researchers identify regulator of critical brain messenger, hinting at therapy

...chemical signal to its launch site in nerve cells, offering a possible new target for treating such diseases as Alzheimer's disease. The discovery opens a vast field of potential therapy, for while glutamate carries out such fundamental processes as sensory perception, learning and memory, changes in its role...

Fisher Scientific launches EinsteinsGarage: buyers and sellers get deals on surplus science equipment

..." added Montrone. "In addition to its auction site offering tremendous product breadth, EinsteinsGarage provides valuable services for its customers, such as warehousing product inventory and the repair and calibration of laboratory equipment." Additional information on EinsteinsGarage platform is p...

Putting a price tag on paradise

...tradeoffs no matter how you look at it. What we're offering is a framework for thinking about these tradeoffs. "As the population approaches 10 billion people, we'll continue to fight over smaller and smaller scraps of land and fewer resources," she notes. "Never before has society been faced with these kind...

UNC-CH researchers to study social effects of N.C. hurricane

...n't read everything written on the sides of trucks offering assistance, so bingo, the project was born," Francis said. "Adult literacy is an often unspoken problem, and the non-reading community often is an unseen community that can be overlooked during a natural disaster. I am interested in what happens when...

Weight training helps to maintain good health, study finds

... the changes in muscle fiber composition and size, offering a broader view of the effects of strength training on all aspects of the muscle and body. "We had an advantage over other studies because we did so much data collection," Staron said. "We conducted blood tests and biopsies, so we were actually able ...

Biological legacies a key of ecological rebirth after Mount St. Helens eruption

... edges. The exposed soil became aircraft carriers offering a safe landing for seeds carried in the air or tumbled along the ground by the wind, he says. Wind-borne seeds landed everywhere, of course, but those in the die-back areas had decided advantages. And, it turns out, the next-generation of these lon...

Study finds elderly women can halt bone loss

...ance and the OSU Extension Service. In addition to offering a series of classes, university researchers and educators have offered instructor training workshops throughout the state. For more information on the outreach, call 541-737-2713. The study, initiated by former OSU doctoral student Janet Shaw, ...

Biomarkers: testing for alcohol consumption among women

...asuring heavy alcohol consumption. "We will begin offering this test in our lab within the next few months," he said. Javors noted that future research could go in several different directions. "Not enough studies have been done to compare the value of these markers for the detection of binge drinking ver...

BioMed Central to free scientists and clinical researchers from copyright restrictions

...medical publishing by focusing on adding value and offering services that complement the freely-available original research and literature of the future." BioMed Central will, in addition to publishing primary research papers free-of-charge on the internet, provide commentary, reviews, news, alerting services...

Drosophila genome sequence completed

... of the way was my friend," says Rubin. "They were offering to do all this work in a collaborative way and not expecting any money for it." Celera started the sequencing last April and finished collecting the raw data in early September. "Since then," says Rubin, "we1ve been putting all the pieces togeth...

UMass microbiologist's Nature article contributes to understanding of how cells divide

...icrobiologist is one of a group of six researchers offering a major step forward in developing a model explaining DNA repair, recombination, and replication, in a report appearing in today's issue of the journal Nature. The study, "Re-establishment of Inactivated Replication Forks as a Bacterial Housekeepin...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... DiscountFurnaceFilter.com, the number one solution for homeowner’s ... Compressor Saver kit at an exceptional price. The 5-2-1 Compressor ... air conditioning unit during start up, saving wear and tear ... unit burn out. , The 5-2-1 Compressor Saver ... uses less power to start and drastically reduces the rush ...
(Date:6/19/2013)... 19, 2013 Kansas City will host its first ... Street Day . A section of Main Street in the midtown ... afternoon of the event. The Main Street Corridor Development ... will help Kansas City join the ranks of dozens of cities ... tool to foster community vibrancy and active lifestyles. , “Ciclovia is ...
(Date:6/19/2013)... June 19, 2013 In 2011, the ... EUR 710 million. Generic drugs form the largest sector, ... value. The pharmaceutical industry is a significant contributor to ... the country’s GDP. Approximately 50% of the total domestic ... pharmaceutical industry. Hemofarm, Galenika and Zdravlje Actavis are key ...
(Date:6/19/2013)... Elsevier, a world-leading provider of scientific, technical ... the publication of the National Osteoporosis Guideline Group ... osteoporosis in postmenopausal women and older men in ... 2009 in Maturitas , the original guidelines ... timely with an additional focus on the management ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
Breaking Medicine News(10 mins):Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 2Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 3Health News:Serbian Pharmaceutical Market Scrutinized by CUBE in Topical Report Now Available at MarketPublishers.com 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5
Other Tags
nevadaclocksfitnesskeepsprimevalantiangiogenichorizonsubmitapheresisrenownedareprioritiescortexgambiaopposeshivmaputs