Tag: "orchid" at biology news

Purdue Scientist Wants To Find Out What Went Sour With Flowers

... are identicalamong plants of the same variety. An orchid could produce about 100 differentvolatile compounds, while a snapdragon produces about seven to 10. While muchhas been done to analyze the composition of scent, we're just learning about thegenes that produce the compounds and how they are given off....

Blister beetles use sex and subterfuge to infiltrate bee's nests

...sociated with individuals of a species. The Ophrys orchid mimics the appearance and scent of female bees to attract pollinators to its flower, and female bolas spiders attract prey by mimicking the female sex pheromone of the armyworm. Dr. Ronald McGinley of the Smithsonian Institution's Department of Ento...

Eaten as food, African orchids threatened by illegal trade

...cance. But the plateau is currently under intense orchid harvesting pressure. The report says that up to 85...will be wiped out in a matter of a few years. All orchid species are protected by CITES (Convention on International Trade in Endangered Species), which requ...

Mountain cloud forests imperiled by lowland deforestation, says Science study

...lden toads, the jaguar, 5000 moth species, and 400 orchid species. Cloud forests in the Caribbean form where mountain peaks force trade winds up past the point where clouds condense, leaving the windward side of the mountains immersed in a nearly perpetual bank of clouds. The cloud bank provides moisture in...

Botanists discover new conifer species in Vietnam

...s exploring the area has found about two dozen new orchid species, a variety of interesting new shrubs, and numerous herbs and bulbs, including a half-dozen new species in the Jack-in-thepulpit family (Araceae)....

New orchid bee guide

A new guide to the orchid bees of tropical America is now available. Co-aut...al field guide provides a "comprehensive review of orchid bee studies aimed at both biologists and those bold enough approach rainforest bees out of curiosity...

1

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue