Tag: "ordinary" at biology news

From Corn Rootworms To Art, Cornell's Reactor Is At The Core

...lines show the path of the rootworm," she says. No ordinary pictures, these. Allee is making use of a Cornell resource to study, along with Paula Davis, assistant professor of entomology, the behavior of this major corn pest in the hope of developing a natural way to control it. By using the 500-kilowatt nuc...

New Discovery About Genes Has Implications For Genetic Therapy

...on the simple organism Saccharomyces cerevisiae , ordinary baker's yeast. The yeast is widely used both in brewing and by geneticists for their research. Genes are basically long strands of DNA that carry the essential genetic information needed to produce a protein. Scientists believed that only certai...

Summer Science: Firefly Babies Advertise Their Bitter Taste, UD Researchers Say

...cs, Tallamy tested theaposematic display theory on ordinary house mice raised in a laboratory. Butfirst, the UD researchers needed to find out whether mice think firefly larvaetaste bad. In previous laboratory studies, vertebrate predators have consistently turned uptheir noses at lucibufagins, compounds pres...

Tiger Beetles Go Blind At High Speeds

...t is fast for a tiger beetle? Gilbert compared an ordinary tiger beetle to Olympic superstar Michael Johnson. Johnson, the world-record holder, can run 200 meters in 19.32 seconds, which averages to a speed of 10.35 meters per second (or 23.1 mph.) "The top speed for my tiger beetles is 0.5387 meters per s...

National Toxicology Program Meets On Transgenic Animals

...ty of environmental agents more rapidly than using ordinary strains of rodents. The tests use fewer animals and cost less. Some of the issues to be addressed are: Is the NTP approach to evaluation and validation of transgenic models sufficient and appropriate? How can existing models be best utilized? Wh...

Women Can Inherit Drinking Problem Too, Study Finds

...cal,twins, who are not more alike genetically than ordinary sisters, were only threetimes more likely to be alcohol dependent if their twin had a drinking problem. The study also examined whether psychiatric disorders that commonly precede orcoexist with alcoholism, such as childhood behavior problems like l...

Plants - Factories Of The Future

...value of epoxy oils is almost three times that of ordinary vegetable oils." This research has revealed a family of enzymes that perform a range of chemical modifications to fatty acids. This knowledge should enable the team to isolate other genes from the family and further expand the types of oils pro...

Peptic Ulcers: Stress Does Matter, After All

...ough wars, earthquakes, or even large doses of the ordinary stresses of life are especially likely to develop ulcers, and ulcer patients who are anxious or under stress have a harder time healing and staying healed." Other research has suggested that psychological stress may push a H.pylori-infected p...

Understanding The Mystery Of Anesthesia

...nsplantation medicine."Also,anesthesia is not like ordinary sleep or other types of unconsciousness,Eckenhoff notes, raising questions about the nature of consciousness itself thatmight be illuminated by the studies. "Once we better understand howunconsciousness works, chances are we'll have new insight into ...

Clever Chemistry Protects Beetle Babies

.... Three different small building blocks related to ordinary fatty acidsare used to assemble the rings. Many different combinations of the buildingblocks then create a highly complex mixture, a library of large rings. The defensive chemicals can be seen under high magnification, as shown in MariaEisner's SEM ...

Turning "Unrecyclable" Waste Into Plastic Products

...quick unified process. Normally they would use an ordinary fresh plastic raw materials for the inside structure of plastic components created by this process but they hit upon the idea that they could also take this waste fluff and seal it inside the coated components, as part of the inner structure, as the...

Angry Biotech Firms Are Blaming The Industry Leader For Bringing Modified Crops Into Disrepute

...y soya beans had been shipped to Europe mixed with ordinary soya. Consumersinterpreted the move as a ploy to force transgenic soya down European throats. Monsanto officials have always maintained that the decision not tosegregate was made by farmers and distributors, but they admit to misjudging them...

Canine Cancer Survivor Is Pet Therapist Helping Kids With Cancer

...TER LOS ANGELES (December 21, 1998) -- Dani is no ordinary dog. It's not just theSanta suit or reindeer antlers that set this beagle apart -- she is a cancersurvivor and an inspiration to the young patients in the Comprehensive CancerCenter at Cedars-Sinai Medical Center, where she's worked as a therapy dog ...

Antibody Revolution Targets STDs, Stomach Viruses, Common Cold

... have discovered that MABs can alsobe derived from ordinary agricultural fields, it now seems likely that theso-called "plantibodies" could reasonably be produced by the boatload at a costof less than $1 per gram. Although it will take a few years to test the MABs in humans and conductsafety tria...

Sandia Decontamination Foam May Be Tomorrow's Best First Response In A Chem-Bio Attack

... arethe most difficult." The foam -- a cocktail of ordinary substances found in common household products-- neutralizes chemical agents in much the same way a detergent lifts away anoily spot from a stained shirt. Its surfactants (like those in hair conditioner)and mild oxidizing substances (like those in too...

Powerful Anti-AIDS Agent Found In Tears And In Urine Of Pregnant Women

... of Medicine and NIH researchers haveidentified an ordinary protein present in tears and saliva as the long-soughtmystery substance in the urine of pregnant women that is a powerful anti-HIVagent. The new finding helps explain why AIDS cannot be transmitted throughsaliva, and opens the way to an entirely new ...

Coffee Without Addiction, Possible New Treatment For Osteoporosis, Wrinkle-Free Cotton, And More

...cides on contact and can bewashed and revived with ordinary bleach. Fire-Resistant Polymers May Aid in Aircraft Fires: New government and academicresearch will be reported on polymers that can resist fire and give off watervapors, providing a possible new tool in reducing the 40 percent of deaths dueto fir...

New Coating Process May Prevent Body From Rejecting Medical Implants

...housands of patients. "We've achieved with ordinary synthetic materials the highly specificlock-and-key fit we see in natural healing, and that has been one of thetoughest hurdles," Ratner says. "The next step is to see if an implant coatedusing our process actually turns on healing in the body." ...

Biggest Bacteria Ever Found

...e largest Thiomargarita was a blue whale, then an ordinary bacterium would be a bitsmaller than a new-born mouse. The largest previously knownbacterium -- Epulopiscum fishelsoni , which lives in the guts ofsurgeonfish -- would be about as big as a lion. Along with lead-author Schulz, the Science p...

Farming's genetic revolution has yet to materialise

...ze had yields 30per cent higher than those growing ordinary crops. "The analysis shows that cropbiotechnology works," claims Margaret Spike of the American Crop ProtectionAssociation in Washington DC. USDA officials, however, admit that at face value the figures don'tprovide much support for those who...

1 2 3 4 5 6

(Date:6/19/2013)... DiscountFurnaceFilter.com, the number one solution for homeowner’s ... Compressor Saver kit at an exceptional price. The 5-2-1 Compressor ... air conditioning unit during start up, saving wear and tear ... unit burn out. , The 5-2-1 Compressor Saver ... uses less power to start and drastically reduces the rush ...
(Date:6/19/2013)... 19, 2013 Kansas City will host its first ... Street Day . A section of Main Street in the midtown ... afternoon of the event. The Main Street Corridor Development ... will help Kansas City join the ranks of dozens of cities ... tool to foster community vibrancy and active lifestyles. , “Ciclovia is ...
(Date:6/19/2013)... June 19, 2013 In 2011, the ... EUR 710 million. Generic drugs form the largest sector, ... value. The pharmaceutical industry is a significant contributor to ... the country’s GDP. Approximately 50% of the total domestic ... pharmaceutical industry. Hemofarm, Galenika and Zdravlje Actavis are key ...
(Date:6/19/2013)... Elsevier, a world-leading provider of scientific, technical ... the publication of the National Osteoporosis Guideline Group ... osteoporosis in postmenopausal women and older men in ... 2009 in Maturitas , the original guidelines ... timely with an additional focus on the management ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
Breaking Medicine News(10 mins):Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 2Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 3Health News:Serbian Pharmaceutical Market Scrutinized by CUBE in Topical Report Now Available at MarketPublishers.com 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5
Other Tags
nevadaclocksfitnesskeepsprimevalantiangiogenichorizonsubmitapheresisrenownedareprioritiescortexgambiaopposeshivmaputs