Tag: "patches" at biology news

Do wildlife corridors work? Studying butterflies and fragments of open space

...and his team studied butterfly movement within 27 patches of open space.Each square patch measured 128 meter... to track the butterflies' visits to differentopen patches within the study area. After two years, the researcher and his team concluded that the butterfliesr...

Butterflies thrive in restored roadside prairies

...ie may provide corridors or steppingstones between patches of butterfly habitat. Compared to butterflies in roadsidegrass, butterflies in prairie are only half as likely to cross the road. Restoring prairie along roads has a huge potential for conservation: Iowa alonehas more than 600,000 acres of roadside ...

A new view of visual system development

.... These neurons are grouped in thevisual cortex in patches called orientation columns, with those responding to agiven type of stimulus occupying the same column. Other neurons are grouped into"ocular dominance columns" according to whether they process information fromthe left or right eye. These columns fo...

USGS fire research in the southeast

...side. Henotes that using fire to protect remaining patches of pine rockland in theNational Key Deer Refuge in the Florida Keys is extremely difficult due to thepresence of houses within and adjoining the refuge property. Even huge areaslike the Everglades and Big Cypress have to deal with air quality issues,...

Carilion, Virginia Tech, U.Va. create biomedical institute -- Virginia Tech forms optical sciences and engineering research center

...en limited. Potential investigations include using patches for:1) diagnosis of target medical or animal conditions, 2) detection of illegal substances, and3) measurement of specific body chemistry. The patch could deliver the correct level of amedicine, such as insulin, or report chemical identification or r...

Sewage in urban runoff may spur growth of harmful algal blooms

...s, of these single-celled plants, leading to dense patches of algae floating near the surface of the ocean that can double in size daily. While most blooms are not harmful, a small number of phytoplankton species can produce potent neurotoxins when they form into a bloom, sometimes poisoning or killing h...

Biological legacies a key of ecological rebirth after Mount St. Helens eruption

...oral and his fellow researchers found was that the patches tended to die back mainly at the edges. The exposed soil became aircraft carriers offering a safe landing for seeds carried in the air or tumbled along the ground by the wind, he says. Wind-borne seeds landed everywhere, of course, but those in the...

UCSD researchers find genetic key to puzzling congenital disease

...s seen in adolescents and adults as pale, hairless patches or streaks. Once most patients reach adulthood (...n with IP often have abnormally shaped teeth, bald patches on the scalp, and missing or deformed nails. Males who inherit the defective gene do not survive. ...

U-M scientist finds molecule plants use to control early cell development

...otein signal called a ligand, which hangs out near patches of unspecialized plant cells called meristems. Another gene, CLAVATA1, encodes a receptor molecule, which penetrates meristem cell walls, with half the receptor on the outside and half inside the cell membrane. When the ligand binds to the outer hal...

Giant jellies invade Gulf of Mexico threatening shrimp fishery

...ave shown that these jellyfish congregate in large patches - in some cases more than 2,000 jellyfish clustering in an area the size of a football field. In response to this invasion, the Mississippi-Alabama Sea Grant Consortium is providing $10,000 in emergency research funding to learn more about these in...

Satellite imagery pinpoints El Niño's disruption of marine ecosystem

... in a critical reduction in the high-concentration patches of phytoplankton that may be necessary for success in the planktonic stages of fish populations. While Kahru and Mitchell documented reductions in satellite estimates of surface phytoplankton for water off central and southern California, they found ...

Study published in NEJM reports that testosterone patch improves sexual function and psychological well-being in surgically postmenopausal women

...12-week treatment periods, receiving two abdominal patches that were changed twice a week. The sexual functio...treatment period. During one treatment phase, both patches were inactive (placebo), containing no testosterone. During another 12-week period, one patch was ac...

Cellular membrane changes associated with acclimation to cold

...ntral nervous system. These slits correlated with patches of internal cell membrane devoid of protein, something that was not seen seen on images of non-hypothermic tissues. The internal cell membrane studied is called the endoplasmic reticulum (ER), a highly folded membrane within the cell consisting of pr...

Taking the long view: examining factors which influence Northern Spotted Owls

...ently conducted by making large, regularly shaped patches with clean edges. Past forest disturbances, the...ldfires tend to leave smaller, irregularly shaped patches with uneven edges. Fire disturbance also leaves a variety of successional stages based upon the fr...

Plant and animal bacteria share cell-killing mechanism

...uivalent of YopJ---a protein called AvrBsT---black patches of dead cells appeared around the infection site. "The leaf induces cell death in areas exposed to the bacteria to prevent it from spreading through the entire plant," explains Kim Orth, Ph.D., a research investigator in the U-M Medical School and f...

New method for studying ocean currents to help fight erosion

... the water, focusing on the white, foamy patches of bubbles left after breaking waves passed. Based on where the foam moved, the software calculated the speed and direction of the currents. Lippmann sai...

Laboratory study confirms skin cancer risks of sun exposure

...t light and melanoma, the scientists first grafted patches of human skin onto the backs of mice. Then, in order to accelerate a disease process thought to unfold over many years, they used a gene-therapy technique to induce overproduction in the mice of an otherwise naturally occurring growth factor. When th...

Prairie fire--UIC-style

...ire to dry vegetation on one of the last surviving patches of virgin prairie in the state. "If we didnt do it, in the long run, the prairie wouldnt survive," says Dennis Nyberg, associate professor of biological sciences and director of the UIC-owned-and-operated James Woodworth Prairie Preserve in the Chi...

Panda habitat not protected by nature reserve, say Science researchers

...ality habitats is a particular worry because these patches are usually "source areas," where pandas reproduce in higher numbers, says Liu. Habitat loss is at least partially responsible for the dramatic decrease in wild pandas in the reserve, according to the research team. The wild panda population plummete...

Fragmentation linked to stress in birds

...cularly sensitive to habitat fragmentation -- even patches as big as 250 acres are missing many species -- but no one knows why. New research offers a clue: birds in fragments have slower-growing feathers. This suggests that they are more stressed, which could decrease survival and reproduction. "There migh...

1 2 3 4 5 6

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument